1UTU - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF NOVEL PROTEIN EMSY TRUNCATE

Authors :   G. B. Chavali, B. P. Basu, A. J. Doherty

Date :   10 Dec 03 (Deposition) - 13 Oct 05 (Release) - 05 Jul 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Chromatin Regulator, Chromatin Regulators, Royal Family Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. M. Ekblad, G. B. Chavali, B. P. Basu, S. M. Freund, D. Veprintsev, L. Hughes-Davies, T. Kouzarides, A. J. Doherty, L. S. Itzhaki
Binding Of Emsy To Hp1Beta: Implications For Recruitment Of Hp1Beta And Bs69.
Embo Rep. V. 6 675 2005
PubMed-ID: 15947784 | Reference-DOI: 10.1038/SJ.EMBOR.7400415

Molecule 1 - EMSY
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	RESIDUES 1-108
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1UTU)

(no "Site" information available for 1UTU)

(no "SS Bond" information available for 1UTU)

(no "Cis Peptide Bond" information available for 1UTU)

(no "SAP(SNP)/Variant" information available for 1UTU)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ENT	PS51138	EMSY N-terminal (ENT) domain profile.	EMSY_HUMAN	16-100	2	A:16-100 B:16-100

Asymmetric/Biological Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000334736	1c	ENSE00001386178	chr11:76156069-76156172	104	EMSY_HUMAN	-	0	0	-	-
1.2a	ENST00000334736	2a	ENSE00002183521	chr11:76157944-76158052	109	EMSY_HUMAN	1-24	24	2	A:11-24 B:10-24	14 15
1.3	ENST00000334736	3	ENSE00001223548	chr11:76162902-76163001	100	EMSY_HUMAN	24-57	34	2	A:24-57 B:24-57	34 34
1.4a	ENST00000334736	4a	ENSE00002152029	chr11:76164358-76164432	75	EMSY_HUMAN	57-82	26	2	A:57-82 B:57-82	26 26
1.6b	ENST00000334736	6b	ENSE00001696572	chr11:76169227-76169402	176	EMSY_HUMAN	82-141	60	2	A:82-107 B:82-105	26 24
1.6e	ENST00000334736	6e	ENSE00001102458	chr11:76170980-76171129	150	EMSY_HUMAN	141-191	51	0	-	-
1.7	ENST00000334736	7	ENSE00001697568	chr11:76174865-76175124	260	EMSY_HUMAN	191-277	87	0	-	-
1.8	ENST00000334736	8	ENSE00001718146	chr11:76183608-76183884	277	EMSY_HUMAN	278-370	93	0	-	-
1.9a	ENST00000334736	9a	ENSE00001152940	chr11:76207259-76207513	255	EMSY_HUMAN	370-455	86	0	-	-
1.10a	ENST00000334736	10a	ENSE00001102425	chr11:76224430-76224579	150	EMSY_HUMAN	455-505	51	0	-	-
1.11b	ENST00000334736	11b	ENSE00001102392	chr11:76227186-76227356	171	EMSY_HUMAN	505-562	58	0	-	-
1.12	ENST00000334736	12	ENSE00001102435	chr11:76234199-76234335	137	EMSY_HUMAN	562-607	46	0	-	-
1.13a	ENST00000334736	13a	ENSE00001102384	chr11:76237506-76237679	174	EMSY_HUMAN	608-665	58	0	-	-
1.14	ENST00000334736	14	ENSE00001102400	chr11:76239312-76239510	199	EMSY_HUMAN	666-732	67	0	-	-
1.15	ENST00000334736	15	ENSE00001152902	chr11:76246939-76247103	165	EMSY_HUMAN	732-787	56	0	-	-
1.16	ENST00000334736	16	ENSE00001102418	chr11:76248839-76248994	156	EMSY_HUMAN	787-839	53	0	-	-
1.17	ENST00000334736	17	ENSE00001152894	chr11:76250643-76250684	42	EMSY_HUMAN	839-853	15	0	-	-
1.18c	ENST00000334736	18c	ENSE00001152887	chr11:76253260-76253411	152	EMSY_HUMAN	853-903	51	0	-	-
1.19c	ENST00000334736	19c	ENSE00001040003	chr11:76255303-76255866	564	EMSY_HUMAN	904-1091	188	0	-	-
1.20a	ENST00000334736	20a	ENSE00001040001	chr11:76256841-76257341	501	EMSY_HUMAN	1092-1258	167	0	-	-
1.22f	ENST00000334736	22f	ENSE00001403769	chr11:76260996-76262586	1591	EMSY_HUMAN	1259-1322	64	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:97
 aligned with EMSY_HUMAN | Q7Z589 from UniProtKB/Swiss-Prot  Length:1322

    Alignment length:97
                                    20        30        40        50        60        70        80        90       100       
           EMSY_HUMAN    11 LSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLV 107
               SCOP domains d1utua1 A:11-107 Emsy                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----ENT  PDB: A:16-100 UniProt: 16-100                                                   ------- PROSITE
           Transcript 1 (1) Exon 1.2a     --------------------------------Exon 1.4a  PDB: A:57-82   ------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.3  PDB: A:24-57            ------------------------Exon 1.6b  PDB: A:82-107   Transcript 1 (2)
                 1utu A  11 LSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLV 107
                                    20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with EMSY_HUMAN | Q7Z589 from UniProtKB/Swiss-Prot  Length:1322

    Alignment length:96
                                    19        29        39        49        59        69        79        89        99      
           EMSY_HUMAN    10 DLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPR 105
               SCOP domains d1utub_ B: Emsy                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ------ENT-1utuB01 B:16-88                                                      ----------------- Pfam domains (1)
           Pfam domains (2) ------ENT-1utuB02 B:16-88                                                      ----------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------ENT  PDB: B:16-100 UniProt: 16-100                                                   ----- PROSITE
           Transcript 1 (1) Exon 1.2a      --------------------------------Exon 1.4a  PDB: B:57-82   ----------------------- Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.3  PDB: B:24-57            ------------------------Exon 1.6b  PDB: B:82-105 Transcript 1 (2)
                 1utu B  10 DLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPR 105
                                    19        29        39        49        59        69        79        89        99

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: ENT-like (3)

Superfamily: ENT-like (3)

Family: Emsy N terminal (ENT) domain-like (3)

Protein domain: Emsy (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1utua1	A:11-107
1b	d1utub_	B:

(no "CATH Domain" information available for 1UTU)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: ENT] (2)

Family: ENT (2)

Homo sapiens (Human) (2)

1a	ENT-1utuB01	B:16-88
1b	ENT-1utuB02	B:16-88

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (EMSY_HUMAN | Q7Z589)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1utu)

	Sites
(no "Sites" information available for 1utu)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1utu)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1utu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EMSY_HUMAN \| Q7Z589
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EMSY_HUMAN \| Q7Z589
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	EMSY_HUMAN \| Q7Z589	:	1uz3 2fmm

1uz3	CRYSTAL STRUCTURE OF NOVEL PROTEIN EMSY

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File