|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 50)
|
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 1UPT) |
(no "Cis Peptide Bond" information available for 1UPT) |
(no "SAP(SNP)/Variant" information available for 1UPT) |
Asymmetric Unit (1, 1)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:169 aligned with ARL1_HUMAN | P40616 from UniProtKB/Swiss-Prot Length:181 Alignment length:169 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 ARL1_HUMAN 13 FGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ 181 SCOP domains d1upta_ A: ADP-ribosylation factor SCOP domains CATH domains 1uptA00 A:13-181 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ARF PDB: - UniProt: 11-177 ---- PROSITE Transcript 1 (1) -----------------------------------Exon 1.3 PDB: A:48-75 -------------------------------------Exon 1.5 PDB: A:113-172 UniProt: 113-172 --------- Transcript 1 (1) Transcript 1 (2) Exon 1.2 PDB: A:13-48 UniProt: 2-48--------------------------Exon 1.4 PDB: A:75-112 -----------------------------------------------------------Exon 1.6 Transcript 1 (2) 1upt A 13 HmTREmRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAmLEEEELRKAILVVFANKQDmEQAmTSSEmANSLGLPALKDRKWQIFKTSATKGTGLDEAmEWLVETLKSRQ 181 | | 22 32 42 52 62 72 82 92 102 112 122 132 | |142 152 162 172 | | 110-MSE 130-MSE | 170-MSE 14-MSE 134-MSE| 18-MSE 139-MSE Chain B from PDB Type:PROTEIN Length:58 aligned with GOGA4_HUMAN | Q13439 from UniProtKB/Swiss-Prot Length:2230 Alignment length:59 2180 2190 2200 2210 2220 GOGA4_HUMAN 2171 EPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMFTSPRSGI 2229 SCOP domains d1uptb_ B: Golgi autoantigen, golgin-245 SCOP domains CATH domains 1uptB00 B:2171-2228 GRIP domain CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript 2 Exon 2.27 [INCOMPLETE]Exon 2.28 PDB: B:2193-2221 2.29b Transcript 2 1upt B 2171 EPTEFEYLRKVLFEYmmGRETKTmAKVITTVLKFPDDQTQKILEREDARLm-SWLRSSS 2228 2180 |2190 | 2200 2210 2220| | 2186-MSE | 2221-MSE 2187-MSE | 2222 2194-MSE Chain C from PDB Type:PROTEIN Length:163 aligned with ARL1_HUMAN | P40616 from UniProtKB/Swiss-Prot Length:181 Alignment length:163 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 ARL1_HUMAN 18 MRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180 SCOP domains d1uptc_ C: ADP-ribosylation factor SCOP domains CATH domains -1uptC00 C:19-180 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ARF PDB: - UniProt: 11-177 --- PROSITE Transcript 1 (1) ------------------------------Exon 1.3 PDB: C:48-75 -------------------------------------Exon 1.5 PDB: C:113-172 UniProt: 113-172 -------- Transcript 1 (1) Transcript 1 (2) Exon 1.2 PDB: C:18-48 --------------------------Exon 1.4 PDB: C:75-112 -----------------------------------------------------------Exon 1.6 Transcript 1 (2) 1upt C 18 mRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAmLEEEELRKAILVVFANKQDmEQAmTSSEmANSLGLPALKDRKWQIFKTSATKGTGLDEAmEWLVETLKSR 180 | 27 37 47 57 67 77 87 97 107 | 117 127 | |137 | 147 157 167 | 177 18-MSE 110-MSE 130-MSE | 170-MSE 134-MSE| 139-MSE Chain D from PDB Type:PROTEIN Length:52 aligned with GOGA4_HUMAN | Q13439 from UniProtKB/Swiss-Prot Length:2230 Alignment length:52 2179 2189 2199 2209 2219 GOGA4_HUMAN 2170 GEPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLM 2221 SCOP domains d1uptd_ D: Golgi autoantigen, golgin-245 SCOP domains CATH domains 1uptD00 D:2170-2220 GRIP domain - CATH domains Pfam domains ---------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------- PROSITE Transcript 2 Exon 2.27 [INCOMPLETE] Exon 2.28 PDB: D:2193-2221 Transcript 2 1upt D 2170 GEPTEFEYLRKVLFEYmmGRETKTmAKVITTVLKFPDDQTQKILEREDARLm 2221 2179 2189 | 2199 2209 2219 | 2186-MSE | 2221-MSE 2187-MSE | 2194-MSE Chain E from PDB Type:PROTEIN Length:168 aligned with ARL1_HUMAN | P40616 from UniProtKB/Swiss-Prot Length:181 Alignment length:168 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 ARL1_HUMAN 13 FGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180 SCOP domains d1upte_ E: ADP-ribosylation factor SCOP domains CATH domains 1uptE00 E:13-180 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ARF PDB: - UniProt: 11-177 --- PROSITE Transcript 1 (1) -----------------------------------Exon 1.3 PDB: E:48-75 -------------------------------------Exon 1.5 PDB: E:113-172 UniProt: 113-172 -------- Transcript 1 (1) Transcript 1 (2) Exon 1.2 PDB: E:13-48 UniProt: 2-48--------------------------Exon 1.4 PDB: E:75-112 -----------------------------------------------------------Exon 1.6 Transcript 1 (2) 1upt E 13 HmTREmRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAmLEEEELRKAILVVFANKQDmEQAmTSSEmANSLGLPALKDRKWQIFKTSATKGTGLDEAmEWLVETLKSR 180 | | 22 32 42 52 62 72 82 92 102 112 122 132 | |142 152 162 172 14-MSE 110-MSE 130-MSE | 170-MSE 18-MSE 134-MSE| 139-MSE Chain F from PDB Type:PROTEIN Length:56 aligned with GOGA4_HUMAN | Q13439 from UniProtKB/Swiss-Prot Length:2230 Alignment length:57 2180 2190 2200 2210 2220 GOGA4_HUMAN 2171 EPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMFTSPRS 2227 SCOP domains d1uptf_ F: Golgi autoantigen, golgin-245 SCOP domains CATH domains 1uptF00 F:2171-2226 GRIP domain CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript 2 Exon 2.27 [INCOMPLETE]Exon 2.28 PDB: F:2193-2221 2.29b Transcript 2 1upt F 2171 EPTEFEYLRKVLFEYmmGRETKTmAKVITTVLKFPDDQTQKILEREDARLm-SWLRS 2226 2180 |2190 | 2200 2210 2220| | 2186-MSE | 2221-MSE 2187-MSE | 2222 2194-MSE Chain G from PDB Type:PROTEIN Length:170 aligned with ARL1_HUMAN | P40616 from UniProtKB/Swiss-Prot Length:181 Alignment length:179 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 ARL1_HUMAN 2 GGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180 SCOP domains d 1up tg_ G: ADP-ribosylation factor SCOP domains CATH domains 1 upt G00 G:11-180 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains (1) -------------Arf-1uptG01 G:15-177 --- Pfam domains (1) Pfam domains (2) -------------Arf-1uptG02 G:15-177 --- Pfam domains (2) Pfam domains (3) -------------Arf-1uptG03 G:15-177 --- Pfam domains (3) Pfam domains (4) -------------Arf-1uptG04 G:15-177 --- Pfam domains (4) Chain H from PDB Type:PROTEIN Length:51 aligned with GOGA4_HUMAN | Q13439 from UniProtKB/Swiss-Prot Length:2230 Alignment length:51 2179 2189 2199 2209 2219 GOGA4_HUMAN 2170 GEPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARL 2220 SCOP domains d1upth_ H: Golgi autoantigen, golgin-245 SCOP domains CATH domains 1uptH00 H:2170-2220 GRIP domain CATH domains Pfam domains (1) -GRIP-1uptH01 H:2171-2213 ------- Pfam domains (1) Pfam domains (2) -GRIP-1uptH02 H:2171-2213 ------- Pfam domains (2) Pfam domains (3) -GRIP-1uptH03 H:2171-2213 ------- Pfam domains (3) Pfam domains (4) -GRIP-1uptH04 H:2171-2213 ------- Pfam domains (4) SAPs(SNPs) --------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------- PROSITE Transcript 2 Exon 2.27 [INCOMPLETE] Exon 2.28 PDB: H:2193-2220 Transcript 2 1upt H 2170 GEPTEFEYLRKVLFEYmmGRETKTmAKVITTVLKFPDDQTQKILEREDARL 2220 2179 2189 | 2199 2209 2219 2186-MSE | 2187-MSE | 2194-MSE
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,C,E,G (ARL1_HUMAN | P40616)
Chain B,D,F,H (GOGA4_HUMAN | Q13439)
|
|
|
|
|
|
|