Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF COLICIN E7 IMMUNITY PROTEIN
 
Authors :  T. -P. Ko, S. -Y. Hsieh, W. -Y. Ku, M. -Y. Tseng, K. -F. Chak, H. S. Yuan
Date :  21 Jun 96  (Deposition) - 07 Jan 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Immunity Protein, Dimeric Structure, Rnase Active Site (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Y. Hsieh, T. P. Ko, M. Y. Tseng, W. Ku, K. F. Chak, H. S. Yuan
A Novel Role Of Imme7 In The Autoregulatory Expression Of The Cole7 Operon And Identification Of Possible Rnase Active Sites In The Crystal Structure Of Dimeric Imme7.
Embo J. V. 16 1444 1997
PubMed-ID: 9135159  |  Reference-DOI: 10.1093/EMBOJ/16.6.1444
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COLICIN E7
    Chains: A, B, C, D
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: IMMUNITY E7 PROTEIN, IMME7

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UNK)

(-) Sites  (0, 0)

(no "Site" information available for 1UNK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UNK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UNK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UNK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UNK)

(-) Exons   (0, 0)

(no "Exon" information available for 1UNK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
            IMM7_ECOLX    1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
               SCOP domains d1unka_ A: ImmE7 protein (Im7)                                                          SCOP domains
               CATH domains 1unkA00 A:1-87  [code=1.10.1200.20, no name defined]                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  1unk A  1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
                                    10        20        30        40        50        60        70        80       


Chain B from PDB  Type:PROTEIN  Length:87
 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
            IMM7_ECOLX    1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
               SCOP domains d1unkb_ B: ImmE7 protein (Im7)                                                          SCOP domains
               CATH domains 1unkB00 B:1-87  [code=1.10.1200.20, no name defined]                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  1unk B  1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
                                    10        20        30        40        50        60        70        80       


Chain C from PDB  Type:PROTEIN  Length:87
 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
            IMM7_ECOLX    1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
               SCOP domains d1unkc_ C: ImmE7 protein (Im7)                                                          SCOP domains
               CATH domains 1unkC00 C:1-87  [code=1.10.1200.20, no name defined]                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  1unk C  1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
                                    10        20        30        40        50        60        70        80       


Chain D from PDB  Type:PROTEIN  Length:87
 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
            IMM7_ECOLX    1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
               SCOP domains d1unkd_ D: ImmE7 protein (Im7)                                                          SCOP domains
               CATH domains 1unkD00 D:1-87  [code=1.10.1200.20, no name defined]                                    CATH domains
           Pfam domains (1) Colicin_Pyocin-1unkD01 D:1-86                                                         - Pfam domains (1)
           Pfam domains (2) Colicin_Pyocin-1unkD02 D:1-86                                                         - Pfam domains (2)
           Pfam domains (3) Colicin_Pyocin-1unkD03 D:1-86                                                         - Pfam domains (3)
           Pfam domains (4) Colicin_Pyocin-1unkD04 D:1-86                                                         - Pfam domains (4)
         Sec.struct. author ......hhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  1unk D  1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Colicin_Pyocin] (11)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (IMM7_ECOLX | Q03708)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0015643    toxic substance binding    Interacting selectively and non-covalently with a toxic substance, a poisonous substance that causes damage to biological systems.
biological process
    GO:0030153    bacteriocin immunity    A process that mediates resistance to a bacteriocin: any of a heterogeneous group of polypeptide antibiotics that are secreted by certain bacterial strains and are able to kill cells of other susceptible (frequently related) strains after adsorption at specific receptors on the cell surface. They include the colicins, and their mechanisms of action vary.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1unk)
 
  Sites
(no "Sites" information available for 1unk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1unk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1unk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IMM7_ECOLX | Q03708: 1ayi 1cei 1mz8 1ujz 1znv 2erh 2jaz 2jb0 2jbg 2k0d 4f37 5ina 7cei

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UNK)