Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF A MUTANT COLICIN E7 IMMUNITY PROTEIN IM7 WITH AN EXTENDED HELIX III
 
Authors :  A. M. Figueiredo, S. B. Whittaker, S. E. Knowling, C. A. Spronk, S. E. Radford, G. R. Moore
Date :  01 Feb 08  (Deposition) - 20 Jan 09  (Release) - 29 Dec 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  X  (30x)
Keywords :  Protein, Toxin Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. E. Knowling, A. M. Figueiredo, S. B. Whittaker, G. R. Moore, S. E. Radford
Amino Acid Insertion Reveals A Necessary Three-Helical Intermediate In The Folding Pathway Of The Colicin E7 Immunity Protein Im7.
J. Mol. Biol. V. 392 1074 2009
PubMed-ID: 19651139  |  Reference-DOI: 10.1016/J.JMB.2009.07.085
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COLICIN-E7 IMMUNITY PROTEIN
    Chains: X
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: JM109
    Expression System Vector: PTRC99A
    Expression System Vector Type: PLASMID
    Gene: IMM, CEIE7
    Organism Scientific: ESCHERICHIA COLI
    Strain: JM109
    Synonym: IMME7;
MICROCIN-E7 IMMUNITY PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (30x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K0D)

(-) Sites  (0, 0)

(no "Site" information available for 2K0D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K0D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K0D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K0D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2K0D)

(-) Exons   (0, 0)

(no "Exon" information available for 2K0D)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain X from PDB  Type:PROTEIN  Length:93
 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:93
                                                                                           61                            
                                                                                    59   60 | 64 65                      
                                    11        21        31        41        51       | -  | |  | -|       74        84   
            IMM7_ECOLX    2 ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSD----N-RDDS--PEGIVKEIKEWRAANGKPGFKQG 87
               SCOP domains d2k0dx_ X: automated matches                                                                  SCOP domains
               CATH domains 2k0dX00 X:2-94  [code=1.10.1200.20, no name defined]                                          CATH domains
               Pfam domains Colicin_Pyocin-2k0dX01 X:2-93                                                               - Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  2k0d X  2 ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG 94
                                    11        21        31        41        51        61        71        81        91
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Colicin_Pyocin] (11)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain X   (IMM7_ECOLX | Q03708)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0015643    toxic substance binding    Interacting selectively and non-covalently with a toxic substance, a poisonous substance that causes damage to biological systems.
biological process
    GO:0030153    bacteriocin immunity    A process that mediates resistance to a bacteriocin: any of a heterogeneous group of polypeptide antibiotics that are secreted by certain bacterial strains and are able to kill cells of other susceptible (frequently related) strains after adsorption at specific receptors on the cell surface. They include the colicins, and their mechanisms of action vary.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k0d)
 
  Sites
(no "Sites" information available for 2k0d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k0d)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k0d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IMM7_ECOLX | Q03708: 1ayi 1cei 1mz8 1ujz 1unk 1znv 2erh 2jaz 2jb0 2jbg 4f37 5ina 7cei

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K0D)