![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1UJZ) |
(no "Site" information available for 1UJZ) |
(no "SS Bond" information available for 1UJZ) |
(no "Cis Peptide Bond" information available for 1UJZ) |
(no "SAP(SNP)/Variant" information available for 1UJZ) |
(no "PROSITE Motif" information available for 1UJZ) |
(no "Exon" information available for 1UJZ) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:87 aligned with IMM7_ECOLX | Q03708 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 IMM7_ECOLX 1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87 SCOP domains d1ujza_ A: ImmE7 protein (Im7) SCOP domains CATH domains 1ujzA00 A:1-87 [code=1.10.1200.20, no name defined] CATH domains Pfam domains Colicin_Pyocin-1ujzA01 A:1-86 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1ujz A 1 MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:127 aligned with CEA7_ECOLX | Q47112 from UniProtKB/Swiss-Prot Length:576 Alignment length:127 456 466 476 486 496 506 516 526 536 546 556 566 CEA7_ECOLX 447 RNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHHEKPISQNGGVYDMDNISVVTPKRHIDIH 573 SCOP domains d1ujzb_ B: DNase domain of colicin E7 SCOP domains CATH domains 1ujzB00 B:447-573 Colicin e7 immunity protein. Chain B CATH domains Pfam domains Colicin-DNase-1ujzB01 B:447-573 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1ujz B 447 RNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPQTRTQDVSGKRRSFELHHEKPISQNGGVYDMDNISVVTPKRAIDIH 573 456 466 476 486 496 506 516 526 536 546 556 566
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (IMM7_ECOLX | Q03708)
Chain B (CEA7_ECOLX | Q47112)
|
|
|
|
|
|
|