|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1UMQ) |
Sites (0, 0)| (no "Site" information available for 1UMQ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1UMQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UMQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UMQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1UMQ) |
Exons (0, 0)| (no "Exon" information available for 1UMQ) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:60 aligned with REGA_RHOS4 | Q53228 from UniProtKB/Swiss-Prot Length:184 Alignment length:60 134 144 154 164 174 184 REGA_RHOS4 125 LAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR 184 SCOP domains d1umqa_ A: SCOP domains CATH domains 1umqA00 A:22-81 Homeodomain-like CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 1umq A 22 LAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR 81 31 41 51 61 71 81
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1UMQ) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (REGA_RHOS4 | Q53228)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|