Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TRANSPOSASE TC3A1-65 FROM CAENORHABDITIS ELEGANS
 
Authors :  G. Van Pouderoyen, R. F. Ketting, A. Perrakis, R. H. A. Plasterk, T. K. Sixma
Date :  07 Jul 97  (Deposition) - 21 Nov 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Transposase, Dna Binding, Helix-Turn-Helix, Tc1/Mariner Family, Complex (Transposase/Dna), Dna Binding Protein/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Van Pouderoyen, R. F. Ketting, A. Perrakis, R. H. Plasterk, T. K. Sixma
Crystal Structure Of The Specific Dna-Binding Domain Of Tc3 Transposase Of C. Elegans In Complex With Transposon Dna.
Embo J. V. 16 6044 1997
PubMed-ID: 9312061  |  Reference-DOI: 10.1093/EMBOJ/16.19.6044
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA (5'- D(*AP*GP*GP*GP*GP*GP*GP*GP*TP*CP*CP*TP*AP*TP*AP*GP*A P*AP*CP*TP*T)-3')
    ChainsA
    EngineeredYES
    SyntheticYES
 
Molecule 2 - DNA (5'- D(*AP*GP*TP*TP*CP*TP*AP*TP*AP*GP*GP*AP*CP*CP*CP*CP*C P*CP*CP*T)-3')
    ChainsB
    EngineeredYES
    SyntheticYES
 
Molecule 3 - PROTEIN (TC3 TRANSPOSASE)
    ChainsC
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationCYTOPLASM
    Expression System GeneTC3A N1-65
    Expression System PlasmidPRP1200
    Expression System StrainBL21 (DE3) PLYSS
    Expression System Taxid562
    Expression System Vector TypePET3C
    FragmentSPECIFIC DNA BINDING DOMAIN, RESIDUES 2 - 52
    GeneTC3A
    MutationYES
    OrganelleNUCLEUS
    Organism ScientificCAENORHABDITIS ELEGANS
    Organism Taxid6239
    StrainBERGERAC
    VariantTR679

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TC3)

(-) Sites  (0, 0)

(no "Site" information available for 1TC3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TC3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TC3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TC3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TC3)

(-) Exons   (0, 0)

(no "Exon" information available for 1TC3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:DNA  Length:21
                                                     
                 1tc3 A   1 AGGGGGGGTCCTATAGAACTT  21
                                    10        20 

Chain B from PDB  Type:DNA  Length:20
                                                    
                 1tc3 B 101 AGTTCTATAGGACCCCCCCT 120
                                   110       120

Chain C from PDB  Type:PROTEIN  Length:51
 aligned with TC3A_CAEEL | P34257 from UniProtKB/Swiss-Prot  Length:329

    Alignment length:51
                                    11        21        31        41        51 
           TC3A_CAEEL     2 PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIREYLKDPVSYGTS  52
               SCOP domains d1tc3c_ C: Transposase tc3a1-65                     SCOP domains
               CATH domains 1tc3C00 C:202-252 Homeodomain-like                  CATH domains
               Pfam domains -HTH_Tnp_Tc3_1-1tc3C01 C:203-252                    Pfam domains
         Sec.struct. author .......hhhhhhhhhhhh....hhhhhhhh...hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 1tc3 C 202 PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS 252
                                   211       221       231       241       251 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain C   (TC3A_CAEEL | P34257)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0015074    DNA integration    The process in which a segment of DNA is incorporated into another, usually larger, DNA molecule such as a chromosome.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0032502    developmental process    A biological process whose specific outcome is the progression of an integrated living unit: an anatomical structure (which may be a subcellular structure, cell, tissue, or organ), or organism over time from an initial condition to a later condition.
    GO:0006313    transposition, DNA-mediated    Any process involved in a type of transpositional recombination which occurs via a DNA intermediate.
cellular component
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tc3)
 
  Sites
(no "Sites" information available for 1tc3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tc3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tc3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TC3A_CAEEL | P34257
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TC3A_CAEEL | P34257
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TC3A_CAEEL | P342571u78

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TC3)