Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE EUKARYOTIC CLAMP LOADER (REPLICATION FACTOR C, RFC) BOUND TO THE DNA SLIDING CLAMP (PROLIFERATING CELL NUCLEAR ANTIGEN, PCNA)
 
Authors :  G. D. Bowman, M. O'Donnell, J. Kuriyan
Date :  30 Mar 04  (Deposition) - 22 Jun 04  (Release) - 15 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.85
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H
Keywords :  Clamp Loader, Processivity Clamp, Dna Sliding Clamp, Aaa+ Atpase, Dna Polymerase, Dna-Binding Protein, Replication (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. D. Bowman, M. O'Donnell, J. Kuriyan
Structural Analysis Of A Eukaryotic Sliding Dna Clamp-Clamp Loader Complex.
Nature V. 429 724 2004
PubMed-ID: 15201901  |  Reference-DOI: 10.1038/NATURE02585

(-) Compounds

Molecule 1 - ACTIVATOR 1 95 KDA SUBUNIT
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPLANT
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRFC1, CDC44, YOR217W, YOR50-7
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymREPLICATION FACTOR C SUBUNIT 1, REPLICATION FACTOR C1, CELL DIVISION CONTROL PROTEIN 44
 
Molecule 2 - ACTIVATOR 1 37 KDA SUBUNIT
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET11
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRFC4, YOL094C, O0923
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymREPLICATION FACTOR C SUBUNIT 4, REPLICATION FACTOR C4
 
Molecule 3 - ACTIVATOR 1 40 KDA SUBUNIT
    ChainsC
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET11
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRFC3, YNL290W, N0533
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymREPLICATION FACTOR C SUBUNIT 3, REPLICATION FACTOR C3
 
Molecule 4 - ACTIVATOR 1 41 KDA SUBUNIT
    ChainsD
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET11
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRFC2, YJR068W, J1808
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymREPLICATION FACTOR C SUBUNIT 2, REPLICATION FACTOR C2
 
Molecule 5 - ACTIVATOR 1 40 KDA SUBUNIT
    ChainsE
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPLANT
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRFC5, YBR087W, YBR0810
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymREPLICATION FACTOR C SUBUNIT 5, REPLICATION FACTOR C5
 
Molecule 6 - PROLIFERATING CELL NUCLEAR ANTIGEN
    ChainsF, G, H
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET28
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GenePOL30, YBR088C, YBR0811
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymPCNA

 Structural Features

(-) Chains, Units

  12345678
Asymmetric/Biological Unit ABCDEFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 75)

Asymmetric/Biological Unit (5, 75)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2AGS4Ligand/IonPHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
3MG4Ligand/IonMAGNESIUM ION
4MSE20Mod. Amino AcidSELENOMETHIONINE
5UNK46Mod. Amino Acid

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:360 , AGS A:801BINDING SITE FOR RESIDUE MG A 811
2AC2SOFTWARETHR B:56 , ASP B:114 , AGS B:802 , ARG C:131BINDING SITE FOR RESIDUE MG B 812
3AC3SOFTWARETHR C:60 , ASP C:117 , AGS C:803BINDING SITE FOR RESIDUE MG C 813
4AC4SOFTWARETHR D:72 , ASP D:140 , GLU D:141 , AGS D:804 , ARG E:155BINDING SITE FOR RESIDUE MG D 814
5AC5SOFTWARETHR A:299 , TYR A:302 , ALA A:303 , PRO A:304 , GLN A:309 , VAL A:310 , CYS A:311 , GLY A:356 , ILE A:357 , GLY A:358 , LYS A:359 , THR A:360 , THR A:361 , ASN A:456 , ILE A:514 , ARG A:515 , MG A:811 , ARG B:128 , GLU B:132BINDING SITE FOR RESIDUE AGS A 801
6AC6SOFTWAREVAL B:12 , TYR B:15 , ARG B:16 , PRO B:17 , ILE B:23 , VAL B:24 , GLY B:25 , GLY B:52 , ILE B:53 , GLY B:54 , LYS B:55 , THR B:56 , THR B:57 , ASN B:145 , ARG B:174 , MET B:202 , ARG B:203 , MG B:812 , ARG C:131 , ALA C:156BINDING SITE FOR RESIDUE AGS B 802
7AC7SOFTWAREVAL C:16 , TYR C:19 , ARG C:20 , PRO C:21 , VAL C:27 , TYR C:28 , PRO C:55 , GLY C:56 , THR C:57 , GLY C:58 , LYS C:59 , THR C:60 , SER C:61 , ASN C:148 , LEU C:169 , MET C:205 , ARG C:206 , LEU C:209 , MG C:813 , ARG D:154BINDING SITE FOR RESIDUE AGS C 803
8AC8SOFTWAREVAL D:28 , GLU D:29 , TYR D:31 , ARG D:32 , PRO D:33 , VAL D:39 , THR D:40 , ALA D:41 , PRO D:67 , GLY D:68 , THR D:69 , GLY D:70 , LYS D:71 , THR D:72 , SER D:73 , ASN D:171 , LEU D:228 , ARG D:229 , MG D:814 , ARG E:155 , PRO E:180BINDING SITE FOR RESIDUE AGS D 804
9AC9SOFTWAREVAL E:5 , ARG E:9 , PRO E:10 , SER E:17 , HIS E:18 , PRO E:44 , ASN E:45 , GLY E:46 , THR E:47 , GLY E:48 , LYS E:49 , LYS E:50 , THR E:51 , ILE E:201 , LEU E:230 , ARG E:231 , LEU E:234BINDING SITE FOR RESIDUE ADP E 805

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SXJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SXJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SXJ)

(-) PROSITE Motifs  (2, 6)

Asymmetric/Biological Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PCNA_1PS01251 Proliferating cell nuclear antigen signature 1.PCNA_YEAST34-57
 
 
  3F:34-57
G:34-57
H:34-57
2PCNA_2PS00293 Proliferating cell nuclear antigen signature 2.PCNA_YEAST61-79
 
 
  3F:61-79
G:61-79
H:61-79

(-) Exons   (6, 8)

Asymmetric/Biological Unit (6, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YBR087W1YBR087W.1II:423759-4248231065RFC5_YEAST1-3543541E:4-354 (gaps)351

2.1YBR088C1YBR088C.1II:425760-424984777PCNA_YEAST1-2582583F:1-256
G:1-255
H:1-254
256
255
254

3.1YJR068W1YJR068W.1X:567635-5686961062RFC2_YEAST1-3533531D:26-353328

4.1YNL290W1YNL290W.1XIV:86218-872401023RFC3_YEAST1-3403401C:12-333322

5.1YOL094C1YOL094C.1XV:142555-141584972RFC4_YEAST1-3233231B:7-322316

6.1YOR217W1YOR217W.1XV:749302-7518872586RFC1_YEAST1-8618611A:295-747 (gaps)453

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:441
 aligned with RFC1_YEAST | P38630 from UniProtKB/Swiss-Prot  Length:861

    Alignment length:453
                                   304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744   
           RFC1_YEAST   295 DKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEISKAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLGTSTDKIGLRLDYLPTFRKRLLDPFLKQGADAISSVIEVMDDYYLTKEDWDSIME 747
               SCOP domains d1sxja2 A:295-547 Replication factor C1                                                                                                                                                                                                                      d1sxja1 A:548-693 Replication factor C1                                                                                                              ---------------------     ------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1sxjA03 A:550-666  [code=1.20.272.10, no name defined]                                                               --------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------AAA-1sxjA01 A:349-478                                                                                                             ----------------------------------------------------------------------------------------------------------------------------------------------RFC1-1sxjA02 A:621-747                                                                                                          Pfam domains
         Sec.struct. author ..hhhhhh...hhhhh..hhhhhhhhhhhhhhhhhhhhh..............eeeee.....hhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhh...........----.......eeeee.hhhhh.....hhhhhhhhhhhhh...eeeee.......hhhhh...eeee....hhhhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhh....hhhhhhhhhh...ee.......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..ee........hhhhhhhhhhhhhhhhhhhhh.....---.....................-----......................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 6 Exon 6.1  PDB: A:295-747 (gaps) UniProt: 1-861 [INCOMPLETE]                                                                                                                                                                                                                                                                                                                                                                                                           Transcript 6
                 1sxj A 295 DKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKH----QNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEISKAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLG---xxxxxxxxxxxxxxxxxxxxx-----xxxxxxxxxxxxxxxxxxxxxxxxx 747
                                   304       314       324       334       344       354       364       374       384       394       404  |    414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684        |-  |||||704|||||||714|||    724|||||||734|||||||744|||
                                                                                                                                          407  412                                                                                                                                                                                                                                                                                      693   ||||||705-UNK||714-UNK    |||728-UNK||737-UNK||746-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                            697-UNK||706-UNK||715-UNK   ||||729-UNK||738-UNK||747-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                             698-UNK||707-UNK||716-UNK  |||||730-UNK||739-UNK||  
                                                                                                                                                                                                                                                                                                                                                                                                                                              699-UNK| 708-UNK| 717-UNK ||||| 731-UNK| 740-UNK|  
                                                                                                                                                                                                                                                                                                                                                                                                                                               700-UNK  709-UNK       723-UNK  732-UNK  741-UNK  
                                                                                                                                                                                                                                                                                                                                                                                                                                                701-UNK  710-UNK       724-UNK  733-UNK  742-UNK 
                                                                                                                                                                                                                                                                                                                                                                                                                                                 702-UNK  711-UNK       725-UNK  734-UNK  743-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                  703-UNK  712-UNK       726-UNK  735-UNK  744-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                   704-UNK  713-UNK       727-UNK  736-UNK  745-UNK

Chain B from PDB  Type:PROTEIN  Length:316
 aligned with RFC4_YEAST | P40339 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:316
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316      
           RFC4_YEAST     7 LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK 322
               SCOP domains d1sxjb2 B:7-230 Replication factor C4                                                                                                                                                                                           d1sxjb1 B:231-322 Replication factor C4                                                      SCOP domains
               CATH domains 1sxjB01 B:7-166 P-loop containing nucleotide triphosphate hydrolases                                                                                            1sxjB02 B:167-230  [code=1.10.8.60, no name defined]            1sxjB03 B:231-322  [code=1.20.272.10, no name defined]                                       CATH domains
               Pfam domains --------------------------------------AAA-1sxjB01 B:45-166                                                                                                      --------------------------------------------------------------Rep_fac_C-1sxjB02 B:229-316                                                             ------ Pfam domains
         Sec.struct. author ...hhhhhh...hhhhh...hhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhh.hhhhheeee......hhhhhhhhhhhhhhh.........eeeeee.hhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhh......hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 5 Exon 5.1  PDB: B:7-322 UniProt: 1-323 [INCOMPLETE]                                                                                                                                                                                                                                                                           Transcript 5
                 1sxj B   7 LQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSQCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNK 322
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316      

Chain C from PDB  Type:PROTEIN  Length:322
 aligned with RFC3_YEAST | P38629 from UniProtKB/Swiss-Prot  Length:340

    Alignment length:322
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331  
           RFC3_YEAST    12 NLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFEN 333
               SCOP domains d1sxjc2 C:12-238 Replication factor C3                                                                                                                                                                                             d1sxjc1 C:239-333 Replication factor C3                                                         SCOP domains
               CATH domains 1sxjC01 C:12-169 P-loop containing nucleotide triphosphate hydrolases                                                                                         1sxjC02 C:170-238  [code=1.10.8.60, no name defined]                 1sxjC03 C:239-333  [code=1.20.272.10, no name defined]                                          CATH domains
               Pfam domains -------------------------------------AAA-1sxjC01 C:49-169                                                                                                     -------------------------------------------------------------------Rep_fac_C-1sxjC02 C:237-327                                                                ------ Pfam domains
         Sec.struct. author ..hhhhhh...hhhhh..hhhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhh.hhhhheeee......hhhhhhhhhhhhhhh........eeeee.hhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhh...............hhhhhhhhh...hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 4 Exon 4.1  PDB: C:12-333 UniProt: 1-340 [INCOMPLETE]                                                                                                                                                                                                                                                                                Transcript 4
                 1sxj C  12 NLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSQCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFEN 333
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331  

Chain D from PDB  Type:PROTEIN  Length:328
 aligned with RFC2_YEAST | P40348 from UniProtKB/Swiss-Prot  Length:353

    Alignment length:328
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345        
           RFC2_YEAST    26 PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL 353
               SCOP domains d1sxjd2 D:26-262 Replication factor C2                                                                                                                                                                                                       d1sxjd1 D:263-353 Replication factor C2                                                     SCOP domains
               CATH domains 1sxjD01 D:26-192 P-loop containing nucleotide triphosphate hydrolases                                                                                                  1sxjD02 D:193-262  [code=1.10.8.60, no name defined]                  1sxjD03 D:263-353  [code=1.20.272.10, no name defined]                                      CATH domains
               Pfam domains -----------------------------------AAA-1sxjD01 D:61-192                                                                                                                --------------------------------------------------------------------Rep_fac_C-1sxjD02 D:261-350                                                               --- Pfam domains
         Sec.struct. author hhhhhh.............hhhhhhhhh.......eeee.....hhhhhhhhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhh.......hhhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhheeee....hhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 3 Exon 3.1  PDB: D:26-353 UniProt: 1-353 [INCOMPLETE]                                                                                                                                                                                                                                                                                      Transcript 3
                 1sxj D  26 PWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASQCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL 353
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345        

Chain E from PDB  Type:PROTEIN  Length:317
 aligned with RFC5_YEAST | P38251 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:351
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353 
           RFC5_YEAST     4 WVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSRCLLIRCPAPSDSEISTILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESMALNNELALKSSSPIIKPDWIIVIHKLTRKIVKERSVNSLIECRAVLYDLLAHCIPANIILKELTFSLLDVETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVMCCLD 354
               SCOP domains d1sxje2 E:4-255 Replication factor C5                                                                                                                                                                                                                       d1sxje1 E:256-354 Replication factor C5                                                             SCOP domains
               CATH domains 1sxjE01 E:4-193 P-loop containing nucleotide triphosphate hydrol                  ases                                                                                                        1sxjE02 E:194-257  [code=1.10.8.60, no name defined]            1sxjE03 E:258-354  [code=1.20.272.10, no name defined]                                            CATH domains
               Pfam domains --------------DNA_pol3_delta2-1sxjE01 E:18-194                                                                                                                                                 ---------------------------------------------------------------Rep_fac_C-1sxjE02 E:258-349                                                                 ----- Pfam domains
         Sec.struct. author ........hhhhh..hhhhhhhhhh..........eeee.....hhhhhhhhhhhhhh......------------------..ee...eeee...----.hhhhhhhhhhhhh....------------..eeeeee.....hhhhhhhhhhhhhhh...eeeeeee......hhhhhh..eeee....hhhhhhhhhhhhhhhhh.ee..hhhhhhhhhhhh.hhhhhhhhhhhhhhh...ee........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: E:4-354 (gaps) UniProt: 1-354 [INCOMPLETE]                                                                                                                                                                                                                                                                                                       Transcript 1
                 1sxj E   4 WVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYR------------------NVVSSPYHLEITPS----NDRIVIQELLKEVAQMEQ------------RYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSQCLLIRCPAPSDSEISTILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESMALNNELALKSSSPIIKPDWIIVIHKLTRKIVKERSVNSLIECRAVLYDLLAHCIPANIILKELTFSLLDVETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVMCCLD 354
                                    13        23        33        43        53        63   |     -         -  |     93     |   -|      113       | -         -|      143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353 
                                                                                          67                 86           99  104              121          134                                                                                                                                                                                                                            

Chain F from PDB  Type:PROTEIN  Length:258
 aligned with PCNA_YEAST | P15873 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:258
                              1                                                                                                                                                                                                                                                               
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248        
           PCNA_YEAST     - --MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFND 256
               SCOP domains --d1sxjf1 F:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1sxjf2 F:127-256 Proliferating cell nuclear antigen (PCNA)                                                                        SCOP domains
               CATH domains 1sxjF00 F:-1-256  [code=3.70.10.10, no name defined]                                                                                                                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh.eeeeee...eeeeeee.....eeeeeeee...eeeee....eeeeeehhhhhhhh.......eeeeee.....eeeeeee.....eeeeeeee.................eeeeehhhhhhhhhhhhhh...eeeeeee..eeeeeee...eeeeeee..eee..eeeeeeeeee...eeeeeehhhhhhhhhhhhh...eeeee.....eeeeeee..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------PCNA_1  PDB: F:34-57    ---PCNA_2  PDB: F:61-7--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 --Exon 2.1  PDB: F:1-256 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                               Transcript 2
                 1sxj F  -1 ASmLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGmDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLmDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINImITKETIKFVADGDIGSGSVIIKPFVDmEHPETSIKLEmDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFND 256
                              |      8        18        28        38        48        58        68 |      78        88        98       108       118|      128       138       148       158  |    168       178       188       198|      208       218       228       238       248        
                              |                                                                   70-MSE                                          119-MSE                                   161-MSE                    188-MSE    199-MSE                                                     
                              1-MSE                                                                                                                                                                                                                                                           

Chain G from PDB  Type:PROTEIN  Length:258
 aligned with PCNA_YEAST | P15873 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:258
                               1                                                                                                                                                                                                                                                              
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247        
           PCNA_YEAST     - ---MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN 255
               SCOP domains ---d1sxjg1 G:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1sxjg2 G:127-255 Proliferating cell nuclear antigen (PCNA)                                                                       SCOP domains
               CATH domains -1sxjG00 G:-1-255  [code=3.70.10.10, no name defined]                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhh......eeeeee...eeeeeee.....eeeeeeee...eeee.....eeeeeehhhhhhhhh......eeeeee.......eeeee.....eeeeeee..................eeeeeehhhhhhhhhhhh....eeeeee....eeeeee...eeeeeee.......hhhhh.eeee...eeeeeehhhhhhhhhhh....eeeeee.....eeeeeee..eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------PCNA_1  PDB: G:34-57    ---PCNA_2  PDB: G:61-7-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 ---Exon 2.1  PDB: G:1-255 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                              Transcript 2
                 1sxj G  -2 mASmLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGmDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLmDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINImITKETIKFVADGDIGSGSVIIKPFVDmEHPETSIKLEmDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN 255
                            |  |     7        17        27        37        47        57        67  |     77        87        97       107       117 |     127       137       147       157   |   167       177       187|      197 |     207       217       227       237       247        
                           -2-MSE                                                                  70-MSE                                          119-MSE                                   161-MSE                    188-MSE    199-MSE                                                    
                               1-MSE                                                                                                                                                                                                                                                          

Chain H from PDB  Type:PROTEIN  Length:267
 aligned with PCNA_YEAST | P15873 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:267
                                         1                                                                                                                                                                                                                                                             
                                     -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       
           PCNA_YEAST     - -------------MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF 254
               SCOP domains -------------d1sxjh1 H:1-126 Proliferating cell nuclear antigen (PCNA)                                                                     d1sxjh2 H:127-254 Proliferating cell nuclear antigen (PCNA)                                                                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------1sxjH02 H:127-254 DNA Polymerase III, subunit A, domain 2                                                                        CATH domains
           Pfam domains (1) -------------PCNA_N-1sxjH04 H:1-126                                                                                                        PCNA_C-1sxjH01 H:127-254                                                                                                         Pfam domains (1)
           Pfam domains (2) -------------PCNA_N-1sxjH05 H:1-126                                                                                                        PCNA_C-1sxjH02 H:127-254                                                                                                         Pfam domains (2)
           Pfam domains (3) -------------PCNA_N-1sxjH06 H:1-126                                                                                                        PCNA_C-1sxjH03 H:127-254                                                                                                         Pfam domains (3)
         Sec.struct. author ....................hhhhhhhhhhhhhh...eeeeee...eeeeeee......eeeeeee...eeee.....eeeeeehhhhhhhhh.....eeeeeeee....eeeeeeee....eeeeeeee.................eeeeeehhhhhhhhhhhh....eeeeee....eeeeee...eeeeeee.............eeee...eeeeeehhhhhhhhhhhhh..eeeeee.....eeeeee....eeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------PCNA_1  PDB: H:34-57    ---PCNA_2  PDB: H:61-7------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 -------------Exon 2.1  PDB: H:1-254 UniProt: 1-258 [INCOMPLETE]                                                                                                                                                                                                             Transcript 2
                 1sxj H -12 GLEVLFQGPHmASmLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGmDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLmDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINImITKETIKFVADGDIGSGSVIIKPFVDmEHPETSIKLEmDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF 254
                                    -3|  |     7        17        27        37        47        57        67  |     77        87        97       107       117 |     127       137       147       157   |   167       177       187|      197 |     207       217       227       237       247       
                                     -2-MSE                                                                  70-MSE                                          119-MSE                                   161-MSE                    188-MSE    199-MSE                                                   
                                         1-MSE                                                                                                                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (11, 16)

Asymmetric/Biological Unit

(-) CATH Domains  (5, 16)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (6, 16)

Asymmetric/Biological Unit

(-) Gene Ontology  (41, 105)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (RFC1_YEAST | P38630)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003689    DNA clamp loader activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the opening of the ring structure of the PCNA complex, or any of the related sliding clamp complexes, and their closing around the DNA duplex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0000278    mitotic cell cycle    Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
cellular component
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (RFC4_YEAST | P40339)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003689    DNA clamp loader activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the opening of the ring structure of the PCNA complex, or any of the related sliding clamp complexes, and their closing around the DNA duplex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
cellular component
    GO:0031390    Ctf18 RFC-like complex    A heptameric complex related to replication factor C, which loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA and plays a vital role in chromosome cohesion. In Saccharomyces the subunits are known as Ctf18p, Rfc2p, Rfc3p, Rfc4p, Rfc5p, Dcc1p, and Ctf8p.
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0031391    Elg1 RFC-like complex    A pentameric replication factor C (RLC) complex, which unloads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) from chromatin and has roles in telomere length regulation and other aspects of genome stability. In Saccharomyces the subunits are known as Elg1p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0031389    Rad17 RFC-like complex    A pentameric protein complex related to replication factor C, which loads a trimeric complex of checkpoint proteins (known as the checkpoint clamp or 9-1-1 complex) onto DNA at damage sites; functions in DNA damage cell cycle checkpoints. In Schizosaccharomyces pombe the subunits are known as Rad17, Rfc2, Rfc3, Rfc4, and Rfc5, while in Saccharomyces cerevisiae the subunits are known as Rad24p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C   (RFC3_YEAST | P38629)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003689    DNA clamp loader activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the opening of the ring structure of the PCNA complex, or any of the related sliding clamp complexes, and their closing around the DNA duplex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
cellular component
    GO:0031390    Ctf18 RFC-like complex    A heptameric complex related to replication factor C, which loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA and plays a vital role in chromosome cohesion. In Saccharomyces the subunits are known as Ctf18p, Rfc2p, Rfc3p, Rfc4p, Rfc5p, Dcc1p, and Ctf8p.
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0031391    Elg1 RFC-like complex    A pentameric replication factor C (RLC) complex, which unloads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) from chromatin and has roles in telomere length regulation and other aspects of genome stability. In Saccharomyces the subunits are known as Elg1p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0031389    Rad17 RFC-like complex    A pentameric protein complex related to replication factor C, which loads a trimeric complex of checkpoint proteins (known as the checkpoint clamp or 9-1-1 complex) onto DNA at damage sites; functions in DNA damage cell cycle checkpoints. In Schizosaccharomyces pombe the subunits are known as Rad17, Rfc2, Rfc3, Rfc4, and Rfc5, while in Saccharomyces cerevisiae the subunits are known as Rad24p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain D   (RFC2_YEAST | P40348)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003689    DNA clamp loader activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the opening of the ring structure of the PCNA complex, or any of the related sliding clamp complexes, and their closing around the DNA duplex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0017076    purine nucleotide binding    Interacting selectively and non-covalently with purine nucleotides, any compound consisting of a purine nucleoside esterified with (ortho)phosphate.
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0000076    DNA replication checkpoint    A cell cycle checkpoint that prevents the initiation of nuclear division until DNA replication is complete, thereby ensuring that progeny inherit a full complement of the genome.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
cellular component
    GO:0031390    Ctf18 RFC-like complex    A heptameric complex related to replication factor C, which loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA and plays a vital role in chromosome cohesion. In Saccharomyces the subunits are known as Ctf18p, Rfc2p, Rfc3p, Rfc4p, Rfc5p, Dcc1p, and Ctf8p.
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0031391    Elg1 RFC-like complex    A pentameric replication factor C (RLC) complex, which unloads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) from chromatin and has roles in telomere length regulation and other aspects of genome stability. In Saccharomyces the subunits are known as Elg1p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0031389    Rad17 RFC-like complex    A pentameric protein complex related to replication factor C, which loads a trimeric complex of checkpoint proteins (known as the checkpoint clamp or 9-1-1 complex) onto DNA at damage sites; functions in DNA damage cell cycle checkpoints. In Schizosaccharomyces pombe the subunits are known as Rad17, Rfc2, Rfc3, Rfc4, and Rfc5, while in Saccharomyces cerevisiae the subunits are known as Rad24p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain E   (RFC5_YEAST | P38251)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003689    DNA clamp loader activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the opening of the ring structure of the PCNA complex, or any of the related sliding clamp complexes, and their closing around the DNA duplex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
cellular component
    GO:0031390    Ctf18 RFC-like complex    A heptameric complex related to replication factor C, which loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA and plays a vital role in chromosome cohesion. In Saccharomyces the subunits are known as Ctf18p, Rfc2p, Rfc3p, Rfc4p, Rfc5p, Dcc1p, and Ctf8p.
    GO:0005663    DNA replication factor C complex    A complex that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase. In eukaryotes the complex consists of five polypeptides.
    GO:0031391    Elg1 RFC-like complex    A pentameric replication factor C (RLC) complex, which unloads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) from chromatin and has roles in telomere length regulation and other aspects of genome stability. In Saccharomyces the subunits are known as Elg1p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0031389    Rad17 RFC-like complex    A pentameric protein complex related to replication factor C, which loads a trimeric complex of checkpoint proteins (known as the checkpoint clamp or 9-1-1 complex) onto DNA at damage sites; functions in DNA damage cell cycle checkpoints. In Schizosaccharomyces pombe the subunits are known as Rad17, Rfc2, Rfc3, Rfc4, and Rfc5, while in Saccharomyces cerevisiae the subunits are known as Rad24p, Rfc2p, Rfc3p, Rfc4p, and Rfc5p.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain F,G,H   (PCNA_YEAST | P15873)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0030337    DNA polymerase processivity factor activity    An enzyme regulator activity that increases the processivity of polymerization by DNA polymerase, by allowing the polymerase to move rapidly along DNA while remaining topologically bound to it.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0030466    chromatin silencing at silent mating-type cassette    Repression of transcription at silent mating-type loci by alteration of the structure of chromatin.
    GO:0006348    chromatin silencing at telomere    Repression of transcription of telomeric DNA by altering the structure of chromatin.
    GO:0070987    error-free translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
    GO:0034087    establishment of mitotic sister chromatid cohesion    The process in which the sister chromatids of a replicated chromosome become joined along the entire length of the chromosome during S phase during a mitotic cell cycle.
    GO:0006273    lagging strand elongation    The synthesis of DNA from a template strand in a net 3' to 5' direction. Lagging strand DNA elongation proceeds by discontinuous synthesis of short stretches of DNA, known as Okazaki fragments, from RNA primers; these fragments are then joined by DNA ligase. Although each segment of nascent DNA is synthesized in the 5' to 3' direction, the overall direction of lagging strand synthesis is 3' to 5', mirroring the progress of the replication fork.
    GO:0006272    leading strand elongation    The synthesis of DNA from a template strand in the 5' to 3' direction; leading strand elongation is continuous as it proceeds in the same direction as the replication fork.
    GO:0035753    maintenance of DNA trinucleotide repeats    Any process involved in sustaining the fidelity and copy number of DNA trinucleotide repeats. DNA trinucleotide repeats are naturally occurring runs of three base-pairs.
    GO:0000710    meiotic mismatch repair    A system for the identification and correction of base-base mismatches, small insertion-deletion loops, and regions of heterology that are present in duplex DNA formed with strands from two recombining molecules. Correction of the mismatch can result in non-Mendelian segregation of alleles following meiosis.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0000278    mitotic cell cycle    Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
    GO:0007064    mitotic sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome are joined along the entire length of the chromosome, from their formation in S phase through metaphase during a mitotic cell cycle. This cohesion cycle is critical for high fidelity chromosome transmission.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:1902394    positive regulation of exodeoxyribonuclease activity    Any process that activates or increases the frequency, rate or extent of exodeoxyribonuclease activity.
    GO:1903022    positive regulation of phosphodiesterase activity, acting on 3'-phosphoglycolate-terminated DNA strands    Any process that activates or increases the frequency, rate or extent of phosphodiesterase activity, acting on 3'-phosphoglycolate-terminated DNA strands.
    GO:0006301    postreplication repair    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication. Includes pathways that remove replication-blocking lesions in conjunction with DNA replication.
    GO:0006275    regulation of DNA replication    Any process that modulates the frequency, rate or extent of DNA replication.
cellular component
    GO:0043626    PCNA complex    A protein complex composed of three identical PCNA monomers, each comprising two similar domains, which are joined in a head-to-tail arrangement to form a homotrimer. Forms a ring-like structure in solution, with a central hole sufficiently large to accommodate the double helix of DNA. Originally characterized as a DNA sliding clamp for replicative DNA polymerases and as an essential component of the replisome, and has also been shown to be involved in other processes including Okazaki fragment processing, DNA repair, translesion DNA synthesis, DNA methylation, chromatin remodeling and cell cycle regulation.
    GO:0000781    chromosome, telomeric region    The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005657    replication fork    The Y-shaped region of a replicating DNA molecule, resulting from the separation of the DNA strands and in which the synthesis of new strands takes place. Also includes associated protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    AGS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sxj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sxj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PCNA_YEAST | P15873
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RFC1_YEAST | P38630
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RFC2_YEAST | P40348
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RFC3_YEAST | P38629
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RFC4_YEAST | P40339
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RFC5_YEAST | P38251
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PCNA_YEAST | P15873
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RFC1_YEAST | P38630
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RFC2_YEAST | P40348
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RFC3_YEAST | P38629
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RFC4_YEAST | P40339
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RFC5_YEAST | P38251
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PCNA_YEAST | P158731plq 1plr 2od8 3f1w 3gpm 3gpn 3k4x 3l0w 3l0x 3l10 3pge 3v60 3v61 3v62 4l60 4l6p 4yhr 5jne 5t9d

(-) Related Entries Specified in the PDB File

1plq YEAST PCNA