Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF IMPORTIN BETA BOUND TO THE IBB DOMAIN OF IMPORTIN ALPHA
 
Authors :  G. Cingolani, C. Petosa, K. Weis, C. W. Muller
Date :  29 Apr 99  (Deposition) - 24 May 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transport Receptor, Nuclear Import, Heat Motif, Nls-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Cingolani, C. Petosa, K. Weis, C. W. Muller
Structure Of Importin-Beta Bound To The Ibb Domain Of Importin-Alpha.
Nature V. 399 221 1999
PubMed-ID: 10353244  |  Reference-DOI: 10.1038/20367
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (IMPORTIN BETA SUBUNIT)
    Cellular Location: CYTOPLASM
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PEQ60
    Expression System Strain: M15
    Expression System Taxid: 562
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: KARYOPHERIN BETA-1, NUCLEAR FACTOR P97, IMPORTIN B
 
Molecule 2 - PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)
    Chains: B
    Engineered: YES
    Fragment: IBB DOMAIN
    Other Details: THIS PROTEIN IS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THIS PROTEIN IS NATURALLY FOUND IN THE CYTOPLASM OF HOMO SAPIENS (HUMAN).
    Synonym: IMPORTIN ALPHA-2 SUBUNIT, KARYOPHERIN ALPHA-2 SUBUNIT, SRP1-ALPHA
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1QGK)

(-) Sites  (0, 0)

(no "Site" information available for 1QGK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QGK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QGK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QGK)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IMPORTIN_B_NTPS50166 Importin-beta N-terminal domain profile.IMB1_HUMAN21-101  1A:21-101
2HEAT_REPEATPS50077 HEAT repeat profile.IMB1_HUMAN409-446  1A:409-446

(-) Exons   (23, 23)

Asymmetric/Biological Unit (23, 23)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002901581ENSE00001328366chr17:45727275-45727650376IMB1_HUMAN1-14141A:1-1414
1.2ENST000002901582ENSE00001110328chr17:45727752-4572781059IMB1_HUMAN14-33201A:14-3320
1.3ENST000002901583ENSE00001043051chr17:45730060-45730242183IMB1_HUMAN34-94611A:34-9461
1.4ENST000002901584ENSE00000924979chr17:45734226-45734426201IMB1_HUMAN95-161671A:95-16167
1.5ENST000002901585ENSE00000924980chr17:45735874-45736026153IMB1_HUMAN162-212511A:162-21251
1.6ENST000002901586ENSE00000924981chr17:45738485-4573854460IMB1_HUMAN213-232201A:213-23220
1.7ENST000002901587ENSE00000924982chr17:45740455-4574054490IMB1_HUMAN233-262301A:233-26230
1.8ENST000002901588ENSE00000924983chr17:45741525-45741635111IMB1_HUMAN263-299371A:263-29937
1.9ENST000002901589ENSE00000924984chr17:45742423-45742524102IMB1_HUMAN300-333341A:300-33334
1.10ENST0000029015810ENSE00000924985chr17:45745552-45745776225IMB1_HUMAN334-408751A:334-40875
1.11ENST0000029015811ENSE00001043047chr17:45747044-45747235192IMB1_HUMAN409-472641A:409-47264
1.12ENST0000029015812ENSE00000924987chr17:45748068-45748198131IMB1_HUMAN473-516441A:473-51644
1.13ENST0000029015813ENSE00001043027chr17:45750384-45750531148IMB1_HUMAN516-565501A:516-56550
1.14ENST0000029015814ENSE00000924989chr17:45750856-4575092772IMB1_HUMAN566-589241A:566-58924
1.15ENST0000029015815ENSE00000924990chr17:45752004-45752148145IMB1_HUMAN590-638491A:590-63849
1.16ENST0000029015816ENSE00000924991chr17:45753775-4575385783IMB1_HUMAN638-665281A:638-66528
1.17ENST0000029015817ENSE00000924992chr17:45754386-45754493108IMB1_HUMAN666-701361A:666-70136
1.18ENST0000029015818ENSE00000924993chr17:45755412-45755555144IMB1_HUMAN702-749481A:702-74948
1.19ENST0000029015819ENSE00000924994chr17:45755674-45755779106IMB1_HUMAN750-785361A:750-78536
1.20ENST0000029015820ENSE00000924995chr17:45757386-45757500115IMB1_HUMAN785-823391A:785-82339
1.21ENST0000029015821ENSE00000924996chr17:45757874-45758035162IMB1_HUMAN823-877551A:823-87654
1.22ENST0000029015822ENSE00001343442chr17:45759770-457609981229IMB1_HUMAN877-87820--
2.1ENST000003304591ENSE00001673356chr17:66031848-66031956109IMA1_HUMAN-00--
2.2ENST000003304592ENSE00002150216chr17:66033226-6603332398IMA1_HUMAN1-25251B:11-2515
2.3ENST000003304593ENSE00001697155chr17:66033474-66033611138IMA1_HUMAN26-71461B:26-5429
2.4ENST000003304594ENSE00001771132chr17:66036794-6603688289IMA1_HUMAN72-101300--
2.5ENST000003304595ENSE00001684697chr17:66038201-66038469269IMA1_HUMAN101-191910--
2.6ENST000003304596ENSE00001643282chr17:66039021-6603911595IMA1_HUMAN191-222320--
2.7ENST000003304597ENSE00001723038chr17:66039216-66039479264IMA1_HUMAN223-310880--
2.8ENST000003304598ENSE00001716874chr17:66039954-66040187234IMA1_HUMAN311-388780--
2.9ENST000003304599ENSE00001712528chr17:66040437-66040619183IMA1_HUMAN389-449610--
2.10ENST0000033045910ENSE00001781256chr17:66041888-66042037150IMA1_HUMAN450-499500--
2.11ENST0000033045911ENSE00001735149chr17:66042620-66042969350IMA1_HUMAN500-529300--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:876
 aligned with IMB1_HUMAN | Q14974 from UniProtKB/Swiss-Prot  Length:876

    Alignment length:876
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870      
           IMB1_HUMAN     1 MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA 876
               SCOP domains d1qgka_ A: Importin beta                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1qgkA00 A:1-876 Leucine-rich Repeat Variant                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  CATH domains
               Pfam domains --------------------IBN_N-1qgkA02 A:21-101                                                           ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Arm-1qgkA01 A:399-437                  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhh......hhhhhhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhh....hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh.hhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhh...hhhhhhhhhhhhhhhhh.hhh......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.......hhhh..hhhhhhhhhhhhhhhhhhh.........hhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------IMPORTIN_B_NT  PDB: A:21-101 UniProt: 21-101                                     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT_REPEAT  PDB: A:409-446           ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1      -------------------Exon 1.3  PDB: A:34-94 UniProt: 34-94                        Exon 1.4  PDB: A:95-161 UniProt: 95-161                            Exon 1.5  PDB: A:162-212 UniProt: 162-212          Exon 1.6            Exon 1.7  PDB: A:233-262      Exon 1.8  PDB: A:263-299             Exon 1.9  PDB: A:300-333          Exon 1.10  PDB: A:334-408 UniProt: 334-408                                 Exon 1.11  PDB: A:409-472 UniProt: 409-472                      Exon 1.12  PDB: A:473-516 UniProt: 473-516  -------------------------------------------------Exon 1.14  PDB: A:566-58Exon 1.15  PDB: A:590-638 UniProt: 590-638       ---------------------------Exon 1.17  PDB: A:666-701           Exon 1.18  PDB: A:702-749 UniProt: 702-749      Exon 1.19  PDB: A:750-785           -------------------------------------Exon 1.21  PDB: A:823-876 UniProt: 823-877             Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.2            --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.13  PDB: A:516-565 UniProt: 516-565        ------------------------------------------------------------------------Exon 1.16  PDB: A:638-665   -----------------------------------------------------------------------------------------------------------------------Exon 1.20  PDB: A:785-823              ----------------------------------------------------- Transcript 1 (2)
                 1qgk A   1 MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLARWATKELRKLKNQA 876
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870      


Chain B from PDB  Type:PROTEIN  Length:44
 aligned with IMA1_HUMAN | P52292 from UniProtKB/Swiss-Prot  Length:529

    Alignment length:44
                                    20        30        40        50    
           IMA1_HUMAN    11 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS  54
               SCOP domains -------------------------------------------- SCOP domains
               CATH domains 1qgkB00 B:11-54 Single helix bin             CATH domains
               Pfam domains -------------------------------------------- Pfam domains
         Sec.struct. author ...hhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------- PROSITE
               Transcript 2 Exon 2.2       Exon 2.3  PDB: B:26-54        Transcript 2
                 1qgk B  11 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS  54
                                    20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Clan: TPR (230)

(-) Gene Ontology  (42, 58)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (IMB1_HUMAN | Q14974)
molecular function
    GO:0051879    Hsp90 protein binding    Interacting selectively and non-covalently with Hsp90 proteins, any of a group of heat shock proteins around 90kDa in size.
    GO:0008536    Ran GTPase binding    Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0008139    nuclear localization sequence binding    Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0008565    protein transporter activity    Enables the directed movement of proteins into, out of or within a cell, or between cells.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006607    NLS-bearing protein import into nucleus    The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0031291    Ran protein signal transduction    A series of molecular signals within the cell that are mediated by a member of the Ran family of proteins switching to a GTP-bound active state.
    GO:0006309    apoptotic DNA fragmentation    The cleavage of DNA during apoptosis, which usually occurs in two stages: cleavage into fragments of about 50 kbp followed by cleavage between nucleosomes to yield 200 bp fragments.
    GO:0030953    astral microtubule organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of astral microtubules, any of the spindle microtubules that radiate in all directions from the spindle poles.
    GO:0040001    establishment of mitotic spindle localization    The cell cycle process in which the directed movement of the mitotic spindle to a specific location in the cell occurs.
    GO:0045184    establishment of protein localization    The directed movement of a protein to a specific location.
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0007079    mitotic chromosome movement towards spindle pole    The cell cycle process in which the directed movement of chromosomes from the center of the spindle towards the spindle poles occurs. This mediates by the shortening of microtubules attached to the chromosomes, during mitosis.
    GO:0007080    mitotic metaphase plate congression    The cell cycle process in which chromosomes are aligned at the metaphase plate, a plane halfway between the poles of the mitotic spindle, during mitosis.
    GO:0090307    mitotic spindle assembly    The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
    GO:0019054    modulation by virus of host process    The process in which a virus effects a change in the processes and activities of its host organism.
    GO:0000059    obsolete protein import into nucleus, docking    OBSOLETE. A protein complex assembly process that contributes to protein import into the nucleus, and that results in the association of a cargo protein, a carrier protein such as an importin alpha/beta heterodimer, and a nucleoporin located at the periphery of the nuclear pore complex.
    GO:0006606    protein import into nucleus    The directed movement of a protein from the cytoplasm to the nucleus.
    GO:0000060    protein import into nucleus, translocation    A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006610    ribosomal protein import into nucleus    The directed movement of a ribosomal protein from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0071782    endoplasmic reticulum tubular network    A subcompartment of the endoplasmic reticulum consisting of tubules having membranes with high curvature in cross-section.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005635    nuclear envelope    The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0034399    nuclear periphery    The portion of the nuclear lumen proximal to the inner nuclear membrane.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain B   (IMA1_HUMAN | P52292)
molecular function
    GO:0042826    histone deacetylase binding    Interacting selectively and non-covalently with the enzyme histone deacetylase.
    GO:0008139    nuclear localization sequence binding    Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008565    protein transporter activity    Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
    GO:0006259    DNA metabolic process    Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
    GO:0006607    NLS-bearing protein import into nucleus    The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0019054    modulation by virus of host process    The process in which a virus effects a change in the processes and activities of its host organism.
    GO:0006606    protein import into nucleus    The directed movement of a protein from the cytoplasm to the nucleus.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0000018    regulation of DNA recombination    Any process that modulates the frequency, rate or extent of DNA recombination, a DNA metabolic process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qgk)
 
  Sites
(no "Sites" information available for 1qgk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qgk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qgk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IMA1_HUMAN | P52292
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IMB1_HUMAN | Q14974
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IMA1_HUMAN | P52292
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IMB1_HUMAN | Q14974
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IMA1_HUMAN | P52292: 1efx 1qgr 3fex 3fey 3wpt 4e4v 4wv6
        IMB1_HUMAN | Q14974: 1f59 1ibr 1m5n 1o6o 1o6p 1qgr 2p8q 2q5d 2qna 3lww 3w5k

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QGK)