1QBK - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF THE KARYOPHERIN BETA2-RAN GPPNHP NUCLEAR TRANSPORT COMPLEX

Authors :   Y. M. Chook, G. Blobel

Date :   23 Apr 99 (Deposition) - 01 Jun 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : B,C
Biol. Unit 1: B,C  (1x)
Biol. Unit 2: B,C  (2x)

Keywords :   Heat Repeats, Nuclear Transport Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. M. Chook, G. Blobel
Structure Of The Nuclear Transport Complex Karyopherin-Beta2-Ran X Gppnhp.
Nature V. 399 230 1999
PubMed-ID: 10353245 | Reference-DOI: 10.1038/20375
(for further references see the PDB file header)

Molecule 1 - KARYOPHERIN BETA2
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	FULL-LENGTH PROTEIN
	Organ	:	LIVER
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Tissue	:	LIVER

Molecule 2 - RAN
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	FULL-LENGTH PROTEIN
	Organ	:	LIVER
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Tissue	:	LIVER

		1	2
Asymmetric Unit	:	B	C
Biological Unit 1 (1x)	:	B	C
Biological Unit 2 (2x)	:	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 29)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	1	Ligand/Ion	MAGNESIUM ION
3	MSE	27	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (2, 28)

No.	Name	Count	Type	Full Name
1	GNP	1	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	MSE	27	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 2 (2, 56)

No.	Name	Count	Type	Full Name
1	GNP	2	Ligand/Ion	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	MSE	54	Mod. Amino Acid	SELENOMETHIONINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR C:24 , THR C:42 , GNP C:218	BINDING SITE FOR RESIDUE MG C 217
2	AC2	SOFTWARE	GLY C:19 , GLY C:20 , THR C:21 , GLY C:22 , LYS C:23 , THR C:24 , THR C:25 , PHE C:35 , GLU C:36 , LYS C:37 , LYS C:38 , TYR C:39 , ALA C:41 , THR C:42 , GLY C:68 , ASN C:122 , LYS C:123 , ASP C:125 , SER C:150 , ALA C:151 , LYS C:152 , MG C:217	BINDING SITE FOR RESIDUE GNP C 218

(no "SS Bond" information available for 1QBK)

(no "Cis Peptide Bond" information available for 1QBK)

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014455	D	34	E	TNPO1_HUMAN	Polymorphism	25661	B	D	26	E
2	UniProt	VAR_051900	R	95	I	RAN_HUMAN	Polymorphism	11546488	C	R	95	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014455	D	34	E	TNPO1_HUMAN	Polymorphism	25661	B	D	26	E
2	UniProt	VAR_051900	R	95	I	RAN_HUMAN	Polymorphism	11546488	C	R	95	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014455	D	34	E	TNPO1_HUMAN	Polymorphism	25661	B	D	26	E
2	UniProt	VAR_051900	R	95	I	RAN_HUMAN	Polymorphism	11546488	C	R	95	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMPORTIN_B_NT	PS50166	Importin-beta N-terminal domain profile.	TNPO1_HUMAN	41-109	1	B:33-101

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMPORTIN_B_NT	PS50166	Importin-beta N-terminal domain profile.	TNPO1_HUMAN	41-109	1	B:33-101

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMPORTIN_B_NT	PS50166	Importin-beta N-terminal domain profile.	TNPO1_HUMAN	41-109	2	B:33-101

Asymmetric Unit (28, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000337273	1a	ENSE00002137257	chr5:72112139-72112579	441	TNPO1_HUMAN	1-5	5	0	-	-
1.5	ENST00000337273	5	ENSE00001678683	chr5:72144212-72144325	114	TNPO1_HUMAN	6-43	38	1	B:3-35	33
1.6c	ENST00000337273	6c	ENSE00000752304	chr5:72147071-72147146	76	TNPO1_HUMAN	44-69	26	1	B:36-61	26
1.7c	ENST00000337273	7c	ENSE00000534707	chr5:72151601-72151750	150	TNPO1_HUMAN	69-119	51	1	B:61-111	51
1.8a	ENST00000337273	8a	ENSE00000752327	chr5:72157635-72157741	107	TNPO1_HUMAN	119-154	36	1	B:111-146	36
1.10b	ENST00000337273	10b	ENSE00000752440	chr5:72161423-72161556	134	TNPO1_HUMAN	155-199	45	1	B:147-191 (gaps)	45
1.12a	ENST00000337273	12a	ENSE00001659385	chr5:72168466-72168547	82	TNPO1_HUMAN	199-226	28	1	B:191-218	28
1.13	ENST00000337273	13	ENSE00001619386	chr5:72171442-72171564	123	TNPO1_HUMAN	227-267	41	1	B:219-259	41
1.14	ENST00000337273	14	ENSE00001752263	chr5:72173055-72173173	119	TNPO1_HUMAN	268-307	40	1	B:260-299	40
1.15	ENST00000337273	15	ENSE00001797615	chr5:72178294-72178354	61	TNPO1_HUMAN	307-327	21	1	B:299-319	21
1.16c	ENST00000337273	16c	ENSE00001805396	chr5:72178891-72179059	169	TNPO1_HUMAN	328-384	57	1	B:320-376 (gaps)	57
1.17b	ENST00000337273	17b	ENSE00001752488	chr5:72182897-72183049	153	TNPO1_HUMAN	384-435	52	1	B:376-427	52
1.18a	ENST00000337273	18a	ENSE00001670694	chr5:72183905-72184130	226	TNPO1_HUMAN	435-510	76	1	B:427-502	76
1.19	ENST00000337273	19	ENSE00001603550	chr5:72185613-72185784	172	TNPO1_HUMAN	510-567	58	1	B:502-559	58
1.20	ENST00000337273	20	ENSE00001611908	chr5:72187637-72187723	87	TNPO1_HUMAN	568-596	29	1	B:560-588	29
1.21b	ENST00000337273	21b	ENSE00001762530	chr5:72188966-72189073	108	TNPO1_HUMAN	597-632	36	1	B:589-624	36
1.22a	ENST00000337273	22a	ENSE00001717735	chr5:72189204-72189362	159	TNPO1_HUMAN	633-685	53	1	B:625-677	53
1.23	ENST00000337273	23	ENSE00001743796	chr5:72189443-72189530	88	TNPO1_HUMAN	686-715	30	1	B:678-707	30
1.24	ENST00000337273	24	ENSE00001660046	chr5:72192285-72192383	99	TNPO1_HUMAN	715-748	34	1	B:707-740	34
1.25	ENST00000337273	25	ENSE00001687148	chr5:72192883-72192978	96	TNPO1_HUMAN	748-780	33	1	B:740-772	33
1.26	ENST00000337273	26	ENSE00001743811	chr5:72195833-72195908	76	TNPO1_HUMAN	780-805	26	1	B:772-797	26
1.27b	ENST00000337273	27b	ENSE00001600924	chr5:72196801-72196900	100	TNPO1_HUMAN	805-838	34	1	B:797-830	34
1.28	ENST00000337273	28	ENSE00001730129	chr5:72199536-72199610	75	TNPO1_HUMAN	839-863	25	1	B:831-855	25
1.29c	ENST00000337273	29c	ENSE00001718138	chr5:72201130-72201272	143	TNPO1_HUMAN	864-898	35	1	B:856-890	35
1.30f	ENST00000337273	30f	ENSE00001925200	chr5:72204536-72212560	8025	TNPO1_HUMAN	-	0	0	-	-

2.2a	ENST00000392369	2a	ENSE00001511608	chr12:131356783-131357174	392	RAN_HUMAN	1-32	32	1	C:8-32	25
2.2d	ENST00000392369	2d	ENSE00000903701	chr12:131357381-131357465	85	RAN_HUMAN	33-61	29	1	C:33-61	29
2.3	ENST00000392369	3	ENSE00000903703	chr12:131357548-131357673	126	RAN_HUMAN	61-103	43	1	C:61-103	43
2.5b	ENST00000392369	5b	ENSE00000903705	chr12:131359091-131359278	188	RAN_HUMAN	103-165	63	1	C:103-165	63
2.6c	ENST00000392369	6c	ENSE00000903707	chr12:131360157-131360327	171	RAN_HUMAN	166-222	57	1	C:166-197	32
2.7c	ENST00000392369	7c	ENSE00001511600	chr12:131360427-131360826	400	RAN_HUMAN	223-236	14	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain B from PDB  Type:PROTEIN  Length:880
 aligned with TNPO1_HUMAN | Q92973 from UniProtKB/Swiss-Prot  Length:898

    Alignment length:888
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890        
          TNPO1_HUMAN    11 YEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV 898
               SCOP domains d1qbkb_ B: Karyopherin beta2                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbkB00 B:3-890 Leucine-rich Repeat Variant                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------IBN_N-1qbkB02 B:33-101                                               ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT_EZ-1qbkB01 B:411-465                              ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh..hhhhhhhhhhhh............................hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh............hhhhhh..................hhhhh.........hhhhhh.hhhhhhh.---......hhhhhhhhhh.........hhhhhhhhhh......hhhhhhhhhhhh..........hhhhhh..............................hhhhhhhhhhhhh...hhhhhh.......................hhhhhh...........hhhhh.................-----hhhhhh...........hhhhhhhhh..........hhhhhhhhhhhh....hhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..hhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------E------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------IMPORTIN_B_NT  PDB: B:33-101 UniProt: 41-109                         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: B:3-35            Exon 1.6c  PDB: B:36-61   -------------------------------------------------Exon 1.8a  PDB: B:111-146           Exon 1.10b  PDB: B:147-191 (gaps)            ---------------------------Exon 1.13  PDB: B:219-259                Exon 1.14  PDB: B:260-299               --------------------Exon 1.16c  PDB: B:320-376 (gaps) UniProt: 328-384       --------------------------------------------------Exon 1.18a  PDB: B:427-502 UniProt: 435-510                                 ---------------------------------------------------------Exon 1.20  PDB: B:560-588    Exon 1.21b  PDB: B:589-624          Exon 1.22a  PDB: B:625-677 UniProt: 633-685          Exon 1.23  PDB: B:678-707     --------------------------------Exon 1.25  PDB: B:740-772        ------------------------Exon 1.27b  PDB: B:797-830        Exon 1.28  PDB: B:831-855Exon 1.29c  PDB: B:856-890          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.7c  PDB: B:61-111 UniProt: 69-119           -------------------------------------------------------------------------------Exon 1.12a  PDB: B:191-218  --------------------------------------------------------------------------------Exon 1.15            --------------------------------------------------------Exon 1.17b  PDB: B:376-427 UniProt: 384-435         --------------------------------------------------------------------------Exon 1.19  PDB: B:502-559 UniProt: 510-567                ---------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.24  PDB: B:707-740         -------------------------------Exon 1.26  PDB: B:772-797 --------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1qbk B   3 YEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSD---RPLNImIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALmLHIDSFTENLFALAGDEEPEVRKNVCRALVmLLEVRMDRLLPHmHNIVEYmLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGmKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDED-----DDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCmQGmIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLmTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQmLmPPLIQKWNmLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAmLNNAQPDQYEAPDKDFmIVALDLLSGLAEGLGGNIEQLVARSNILTLmYQCmQDKmPEVRQSSFALLGDLTKACFQHVKPCIADFmPILGTNLNPEFISVCNNATWAIGEISIQmGIEmQPYIPmVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPmLQQFIRPWCTSLRNIRDNEEKDSAFRGICTmISVNPSGVIQDFIFFCDAVASWINPKDDLRDmFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV 890
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162   |   172  |    182       192       202       212       222       232       242       252 |     262       272       282       292       302     | 312       322       332       342       352     | 362       372       382       392       402       412       422      |432       442       452       462       472       482       492       502       512       522       532       542       552       562 | |   572  |    582       592       602       612       622 |     632       642       652       662       672   |   682       692       702       712       722       732      |742|     |752       762       772       782      |792       802       812       822       832       842       852       862       872       882        
                                                                                                                                                                                             166 170    |                                210-MSE                        241-MSE      254-MSE  |                                            308-MSE                                     352   358                                                                    429-MSE                                              482-MSE                                                                           564-MSE    575-MSE                                          624-MSE          641-MSE                        672-MSE   |                           710-MSE                      739-MSE     |                                     789-MSE                        820-MSE                         852-MSE                                  
                                                                                                                                                                                                      175-MSE                                                                               261-MSE                                                                                                                                                                    432-MSE                                                                                                                               566-MSE                                                                                                       676-MSE                                                            743-MSE |                                                                                                                                             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               680-MSE                                                              749-MSE

Chain C from PDB  Type:PROTEIN  Length:190
 aligned with RAN_HUMAN | P62826 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:190
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197
            RAN_HUMAN     8 QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQY 197
               SCOP domains d1qbkc_ C: Ran                                                                                                                                                                                 SCOP domains
               CATH domains 1qbkC00 C:8-197 P-loop containing nucleotide triphosphate hydrolases                                                                                                                           CATH domains
               Pfam domains ----Ras-1qbkC01 C:12-170                                                                                                                                           --------------------------- Pfam domains
         Sec.struct. author ....eeee......hhhhhhhhhhh..............eeeeeeee..eeeeeeeee...................eeeee...........hhhhhhhhhh......eeeee..........hhhhhhhhhhh...eee.........hhhhhhhhhhhh............................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2a  PDB: C:8-32   Exon 2.2d  PDB: C:33-61      -----------------------------------------Exon 2.5b  PDB: C:103-165 UniProt: 103-165                     Exon 2.6c  PDB: C:166-197        Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------Exon 2.3  PDB: C:61-103 UniProt: 61-103    ---------------------------------------------------------------------------------------------- Transcript 2 (2)
                 1qbk C   8 QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIImFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAmPALAPPEVVmDPALAAQY 197
                                    17        27        37        47        57        67        77        87 |      97       107       117       127       137       147       157       167       177 |     187 |     197
                                                                                                            89-MSE                                                                                   179-MSE   189-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1qbkC00

C:8-197

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Leucine-rich Repeat Variant (77)

Homologous Superfamily: Leucine-rich Repeat Variant (75)

Human (Homo sapiens) (30)

1qbkB00

B:3-890

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: Ras (176)

Homo sapiens (Human) (141)

Ras-1qbkC01

C:12-170

Clan: TPR (230)

Family: HEAT_EZ (8)

Homo sapiens (Human) (7)

HEAT_EZ-1qbkB01

B:411-465

Family: IBN_N (25)

Homo sapiens (Human) (16)

IBN_N-1qbkB02

B:33-101

Asymmetric Unit(hide GO term definitions)

Chain B (TNPO1_HUMAN | Q92973)

molecular function
	GO:0008536	Ran GTPase binding	Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
	GO:0008139	nuclear localization sequence binding	Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0006607	NLS-bearing protein import into nucleus	The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0000059	obsolete protein import into nucleus, docking	OBSOLETE. A protein complex assembly process that contributes to protein import into the nucleus, and that results in the association of a cargo protein, a carrier protein such as an importin alpha/beta heterodimer, and a nucleoporin located at the periphery of the nuclear pore complex.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0043488	regulation of mRNA stability	Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
	GO:0006610	ribosomal protein import into nucleus	The directed movement of a ribosomal protein from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0034399	nuclear periphery	The portion of the nuclear lumen proximal to the inner nuclear membrane.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C (RAN_HUMAN | P62826)

molecular function
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0050681	androgen receptor binding	Interacting selectively and non-covalently with an androgen receptor.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0045505	dynein intermediate chain binding	Interacting selectively and non-covalently with an intermediate chain of the dynein complex.
	GO:0061676	importin-alpha family protein binding	Interacting selectively and non-covalently with any member of the importin-alpha family.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0070883	pre-miRNA binding	Interacting selectively and non-covalently with a precursor microRNA (pre-miRNA) transcript, a stem-loop-containing precursor of microRNA.
	GO:0090631	pre-miRNA transporter activity	Enables the directed movement of pre-miRNAs between the nucleus and the cytoplasm of a cell.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
biological process
	GO:0006259	DNA metabolic process	Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0030521	androgen receptor signaling pathway	Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0034629	cellular protein complex localization	A protein complex localization process that takes place at the cellular level; as a result, a protein complex is transported to, or maintained in, a specific location within a cell.
	GO:0034613	cellular protein localization	Any process in which a protein is transported to, and/or maintained in, a specific location at the level of a cell. Localization at the cellular level encompasses movement within the cell, from within the cell to the cell surface, or from one location to another at the surface of a cell.
	GO:0071389	cellular response to mineralocorticoid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mineralocorticoid stimulus. Mineralocorticoids are hormonal C21 corticosteroids synthesized from cholesterol and characterized by their similarity to aldosterone. Mineralocorticoids act primarily on water and electrolyte balance.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0007052	mitotic spindle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle during a mitotic cell cycle.
	GO:0006913	nucleocytoplasmic transport	The directed movement of molecules between the nucleus and the cytoplasm.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0035281	pre-miRNA export from nucleus	Transport of pre-microRNAs (pre-miRNAs) from the nucleus to the cytoplasm. Pre-miRNAs are a ~60-70 nucleotide stem loop intermediate in miRNA production, produced by the nuclear cleavage of a primary miRNA (pri-mRNA) transcript. Pre-miRNAs are transported from the nucleus to the cytoplasm where further cleavage occurs to produce a mature miRNA product.
	GO:0006611	protein export from nucleus	The directed movement of a protein from the nucleus into the cytoplasm.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:1902570	protein localization to nucleolus	A process in which a protein is transported to, or maintained in, a location within a nucleolus.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0043393	regulation of protein binding	Any process that modulates the frequency, rate or extent of protein binding.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0000055	ribosomal large subunit export from nucleus	The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
	GO:0000056	ribosomal small subunit export from nucleus	The directed movement of a ribosomal small subunit from the nucleus into the cytoplasm.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0007286	spermatid development	The process whose specific outcome is the progression of a spermatid over time, from its formation to the mature structure.
	GO:0006409	tRNA export from nucleus	The directed movement of tRNA from the nucleus to the cytoplasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0090543	Flemming body	A cell part that is the central region of the midbody characterized by a gap in alpha-tubulin staining. It is a dense structure of antiparallel microtubules from the central spindle in the middle of the intercellular bridge.
	GO:0042565	RNA nuclear export complex	A complex which usually consists of three components, e.g. in Xenopus and yeast, the export receptor CRM1 (also known as exportin 1), the Ran protein and any RNA with a nuclear export sequence (NES). The complex acts to export RNA molecules with a NES from the nucleus through a nuclear pore.
	GO:0005814	centriole	A cellular organelle, found close to the nucleus in many eukaryotic cells, consisting of a small cylinder with microtubular walls, 300-500 nm long and 150-250 nm in diameter. It contains nine short, parallel, peripheral microtubular fibrils, each fibril consisting of one complete microtubule fused to two incomplete microtubules. Cells usually have two centrioles, lying at right angles to each other. At division, each pair of centrioles generates another pair and the twin pairs form the pole of the mitotic spindle.
	GO:0000785	chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0001673	male germ cell nucleus	The nucleus of a male germ cell, a reproductive cell in males.
	GO:0002177	manchette	A tubular array of microtubules that extends from the perinuclear ring surrounding the spermatid nucleus to the flagellar axoneme. The manchette may also contain F-actin filaments.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.
	GO:0036126	sperm flagellum	A microtubule-based flagellum (or cilium) that is part of a sperm, a mature male germ cell that develops from a spermatid.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GNP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qbk)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qbk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RAN_HUMAN \| P62826
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNPO1_HUMAN \| Q92973
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RAN_HUMAN \| P62826
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNPO1_HUMAN \| Q92973
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1QBK)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 29)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (28, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (3, 3)

Gene Ontology (75, 85)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File