1PK6 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   GLOBULAR HEAD OF THE COMPLEMENT SYSTEM PROTEIN C1Q

Authors :   C. Gaboriaud, J. Juanhuix, A. Gruez, M. Lacroix, C. Darnault, D. Pignol, D. Verger, J. C. Fontecilla-Camps, G. J. Arlaud

Date :   05 Jun 03 (Deposition) - 21 Oct 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Complement System, C1Q, Immunology, Jellyroll, Igg, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Gaboriaud, J. Juanhuix, A. Gruez, M. Lacroix, C. Darnault, D. Pignol, D. Verger, J. C. Fontecilla-Camps, G. J. Arlaud
The Crystal Structure Of The Globular Head Of Complement Protein C1Q Provides A Basis For Its Versatile Recognition Properties.
J. Biol. Chem. V. 278 46974 2003
PubMed-ID: 12960167 | Reference-DOI: 10.1074/JBC.M307764200
(for further references see the PDB file header)

Molecule 1 - COMPLEMENT C1Q SUBCOMPONENT, A CHAIN PRECURSOR
	Chains	:	A
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SERUM
	Synonym	:	C1Q

Molecule 2 - COMPLEMENT C1Q SUBCOMPONENT, B CHAIN PRECURSOR
	Chains	:	B
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SERUM
	Synonym	:	C1Q

Molecule 3 - COMPLEMENT C1Q SUBCOMPONENT, C CHAIN PRECURSOR
	Chains	:	C
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SERUM
	Synonym	:	C1Q

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 1)

No.	Name	Count	Type	Full Name
1	CA	1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:177 , ASP B:172 , TYR B:173 , GLN B:179 , HOH B:244 , HOH C:272	BINDING SITE FOR RESIDUE CA B 1

Asymmetric/Biological Unit

No.	Residues
1	A:150	-	A:168
2	B:154	-	B:171
3	C:151	-	C:165

(no "Cis Peptide Bond" information available for 1PK6)

Asymmetric/Biological Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035551	A	123	T	C1QB_HUMAN	Unclassified	776292843	B	A	96	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1PK6)

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000314933	2a	ENSE00001464096	chr1:22979474-22979796	323	C1QB_HUMAN	-	0	0	-	-
1.4	ENST00000314933	4	ENSE00001273267	chr1:22985933-22986136	204	C1QB_HUMAN	1-63	63	0	-	-
1.5c	ENST00000314933	5c	ENSE00001210122	chr1:22987305-22988031	727	C1QB_HUMAN	63-253	191	1	B:92-223	132

2.1a	ENST00000374640	1a	ENSE00001464107	chr1:22970123-22970207	85	C1QC_HUMAN	-	0	0	-	-
2.2	ENST00000374640	2	ENSE00001464106	chr1:22970504-22970697	194	C1QC_HUMAN	1-61	61	0	-	-
2.3b	ENST00000374640	3b	ENSE00001542062	chr1:22973720-22974603	884	C1QC_HUMAN	61-245	185	1	C:89-217	129

3.1	ENST00000374642	1	ENSE00001413929	chr1:22962999-22963195	197	C1QA_HUMAN	-	0	0	-	-
3.3b	ENST00000374642	3b	ENSE00001464114	chr1:22964103-22964272	170	C1QA_HUMAN	1-55	55	0	-	-
3.4c	ENST00000374642	4c	ENSE00001548747	chr1:22965326-22966101	776	C1QA_HUMAN	55-245	191	1	A:90-222	133

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:133
 aligned with C1QA_HUMAN | P02745 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:133
                                   121       131       141       151       161       171       181       191       201       211       221       231       241   
           C1QA_HUMAN   112 QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS 244
               SCOP domains d1pk6a_ A: Complement c1q globular head, A chain                                                                                      SCOP domains
               CATH domains 1pk6A00 A:90-222  [code=2.60.120.40, no name defined]                                                                                 CATH domains
               Pfam domains ----C1q-1pk6A01 A:94-219                                                                                                          --- Pfam domains
         Sec.struct. author ....eeeee.........ee...eeeeee..........ee....eeeeeeeeeee...eeeeeeeee..eee...eeee.......eeeeeeeeeee....eeeeeeeeeee..........eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 3 Exon 3.4c  PDB: A:90-222 UniProt: 55-245 [INCOMPLETE]                                                                                 Transcript 3
                 1pk6 A  90 QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS 222
                                    99       109       119       129       139       149       159       169       179       189       199       209       219

Chain B from PDB  Type:PROTEIN  Length:132
 aligned with C1QB_HUMAN | P02746 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:132
                                   128       138       148       158       168       178       188       198       208       218       228       238       248  
           C1QB_HUMAN   119 TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD 250
               SCOP domains d1pk6b_ B: Complement c1q globular head, B chain                                                                                     SCOP domains
               CATH domains 1pk6B00 B:92-223  [code=2.60.120.40, no name defined]                                                                                CATH domains
               Pfam domains ----C1q-1pk6B01 B:96-220                                                                                                         --- Pfam domains
         Sec.struct. author ....eeeee................eeeeee.........eee....eeeeeeeeeee...eeeeeeee...eeeeeeeee......eeeeeeeeeee....eeeeeeeeee.........eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----T------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.5c  PDB: B:92-223 UniProt: 63-253 [INCOMPLETE]                                                                                Transcript 1
                 1pk6 B  92 TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD 223
                                   101       111       121       131       141       151       161       171       181       191       201       211       221

Chain C from PDB  Type:PROTEIN  Length:129
 aligned with C1QC_HUMAN | P02747 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:129
                                   126       136       146       156       166       176       186       196       206       216       226       236         
           C1QC_HUMAN   117 KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD 245
               SCOP domains d1pk6c_ C: Complement c1q globular head, C chain                                                                                  SCOP domains
               CATH domains 1pk6C00 C:89-217  [code=2.60.120.40, no name defined]                                                                             CATH domains
               Pfam domains ----C1q-1pk6C01 C:93-214                                                                                                      --- Pfam domains
         Sec.struct. author ....eeeee................eeee.....ee....eee....eeeeeeeeeee...eeeeeee..eeeeeeee......eeeeeeeeeee....eeeeeeeeee..........eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.3b  PDB: C:89-217 UniProt: 61-245 [INCOMPLETE]                                                                             Transcript 2
                 1pk6 C  89 KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD 217
                                    98       108       118       128       138       148       158       168       178       188       198       208

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: TNF-like (100)

Superfamily: TNF-like (100)

Family: TNF-like (82)

Protein domain: Complement c1q globular head, A chain (5)

Human (Homo sapiens) [TaxId: 9606] (5)

d1pk6a_

Protein domain: Complement c1q globular head, B chain (3)

Human (Homo sapiens) [TaxId: 9606] (3)

d1pk6b_

Protein domain: Complement c1q globular head, C chain (5)

Human (Homo sapiens) [TaxId: 9606] (5)

d1pk6c_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: [code=2.60.120.40, no name defined] (56)

Human (Homo sapiens) (38)

1a	1pk6A00	A:90-222
1b	1pk6B00	B:92-223
1c	1pk6C00	C:89-217

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: C1q_TNF (45)

Family: C1q (8)

Homo sapiens (Human) (7)

1a	C1q-1pk6A01	A:94-219
1b	C1q-1pk6B01	B:96-220
1c	C1q-1pk6C01	C:93-214

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (C1QA_HUMAN | P02745)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0010039	response to iron ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
cellular component
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0005602	complement component C1 complex	A protein complex composed of six subunits of C1q, each formed of the three homologous polypeptide chains C1QA, C1QB, and C1QB, and tetramer of two C1QR and two C1QS polypeptide chains.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B (C1QB_HUMAN | P02746)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0048839	inner ear development	The process whose specific outcome is the progression of the inner ear over time, from its formation to the mature structure.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0005602	complement component C1 complex	A protein complex composed of six subunits of C1q, each formed of the three homologous polypeptide chains C1QA, C1QB, and C1QB, and tetramer of two C1QR and two C1QS polypeptide chains.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain C (C1QC_HUMAN | P02747)

molecular function
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0030853	negative regulation of granulocyte differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of granulocyte differentiation.
	GO:0045650	negative regulation of macrophage differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of macrophage differentiation.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pk6)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1pk6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	C1QA_HUMAN \| P02745
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	C1QB_HUMAN \| P02746
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	C1QC_HUMAN \| P02747
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	C1QA_HUMAN \| P02745
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	C1QB_HUMAN \| P02746
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	C1QC_HUMAN \| P02747
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	C1QA_HUMAN \| P02745	:	2jg8 2jg9 2wnu 2wnv 5hkj 5hzf
	C1QB_HUMAN \| P02746	:	2jg8 2jg9 2wnu 2wnv 5hkj 5hzf
	C1QC_HUMAN \| P02747	:	2jg8 2jg9 2wnu 2wnv 5hkj 5hzf

1elv	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF HUMAN COMPLEMENT C1S PROTEASE
1gpz	THE CRYSTAL STRUCTURE OF THE ZYMOGEN CATALYTIC DOMAIN OF COMPLEMENT PROTEASE C1R
1nzi	CRYSTAL STRUCTURE OF THE CUB1-EGF INTERACTION DOMAIN OF COMPLEMENT PROTEASE C1S

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (20, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File