1OT3 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF DROSOPHILA DEOXYRIBONUCLEOTIDE KINASE COMPLEXED WITH THE SUBSTRATE DEOXYTHYMIDINE

Authors :   N. E. Mikkelsen, K. Johansson, A. Karlsson, W. Knecht, G. Andersen, J. P B. Munch-Petersen, H. Eklund

Date :   21 Mar 03 (Deposition) - 27 May 03 (Release) - 28 May 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)
Biol. Unit 4: G,H  (1x)

Keywords :   Protein-Deoxynucleoside Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. E. Mikkelsen, K. Johansson, A. Karlsson, W. Knecht, G. Andersen, J. Piskur, B. Munch-Petersen, H. Eklund
Structural Basis For Feedback Inhibition Of The Deoxyribonucleoside Salvage Pathway: Studies Of The Drosophila Deoxyribonucleoside Kinase.
Biochemistry V. 42 5706 2003
PubMed-ID: 12741827 | Reference-DOI: 10.1021/BI0340043

Molecule 1 - DEOXYRIBONUCLEOSIDE KINASE
	Chains	:	A, B, C, D, E, F, G, H
	EC Number	:	2.7.1.145
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PGEX-2T
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Organism Common	:	FRUIT FLY
	Organism Scientific	:	DROSOPHILA MELANOGASTER
	Organism Taxid	:	7227
	Synonym	:	DM-DNK

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F
Biological Unit 4 (1x)	:							G	H

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 17)

No.	Name	Count	Type	Full Name
1	SO4	9	Ligand/Ion	SULFATE ION
2	THM	8	Ligand/Ion	THYMIDINE

Biological Unit 1 (2, 5)

No.	Name	Count	Type	Full Name
1	SO4	3	Ligand/Ion	SULFATE ION
2	THM	2	Ligand/Ion	THYMIDINE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION
2	THM	2	Ligand/Ion	THYMIDINE

Biological Unit 3 (2, 4)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION
2	THM	2	Ligand/Ion	THYMIDINE

Biological Unit 4 (2, 4)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION
2	THM	2	Ligand/Ion	THYMIDINE

Asymmetric Unit (17, 17)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLY A:30 , SER A:31 , GLY A:32 , LYS A:33 , THR A:34 , ARG A:167 , HOH A:1415 , HOH A:1487 , HOH A:1505	BINDING SITE FOR RESIDUE SO4 A 1300
02	AC2	SOFTWARE	ASN D:28 , GLY D:30 , SER D:31 , GLY D:32 , LYS D:33 , THR D:34 , ARG D:167 , HOH D:1412	BINDING SITE FOR RESIDUE SO4 D 1301
03	AC3	SOFTWARE	ASN E:28 , GLY E:30 , SER E:31 , GLY E:32 , LYS E:33 , THR E:34 , ARG E:167 , HOH E:1418	BINDING SITE FOR RESIDUE SO4 E 1302
04	AC4	SOFTWARE	GLY G:30 , SER G:31 , GLY G:32 , LYS G:33 , THR G:34 , ARG G:167 , HOH G:1421	BINDING SITE FOR RESIDUE SO4 G 1303
05	AC5	SOFTWARE	ASN F:28 , GLY F:30 , SER F:31 , GLY F:32 , LYS F:33 , THR F:34 , ARG F:167 , HOH F:1407	BINDING SITE FOR RESIDUE SO4 F 1304
06	AC6	SOFTWARE	ASN C:28 , GLY C:30 , SER C:31 , GLY C:32 , LYS C:33 , THR C:34 , ARG C:167 , HOH C:1420 , HOH C:1421	BINDING SITE FOR RESIDUE SO4 C 1305
07	AC7	SOFTWARE	ASN B:28 , GLY B:30 , SER B:31 , GLY B:32 , LYS B:33 , THR B:34 , ARG B:167 , HOH B:1412 , HOH B:1420	BINDING SITE FOR RESIDUE SO4 B 1306
08	AC8	SOFTWARE	GLY H:30 , SER H:31 , GLY H:32 , LYS H:33 , THR H:34 , ARG H:167 , HOH H:1439 , HOH H:1449	BINDING SITE FOR RESIDUE SO4 H 1307
09	AC9	SOFTWARE	ARG A:169 , ARG H:169	BINDING SITE FOR RESIDUE SO4 A 1308
10	BC1	SOFTWARE	GLU A:52 , TRP A:57 , LEU A:66 , MET A:69 , TYR A:70 , PHE A:80 , GLN A:81 , VAL A:84 , ARG A:105 , ALA A:110 , PHE A:114 , GLU A:172 , HOH A:1403 , HOH A:1487	BINDING SITE FOR RESIDUE THM A 1400
11	BC2	SOFTWARE	GLU D:52 , TRP D:57 , LEU D:66 , MET D:69 , TYR D:70 , PHE D:80 , GLN D:81 , VAL D:84 , ARG D:105 , ALA D:110 , PHE D:114 , GLU D:172 , HOH D:1406	BINDING SITE FOR RESIDUE THM D 1401
12	BC3	SOFTWARE	GLU E:52 , TRP E:57 , LEU E:66 , MET E:69 , TYR E:70 , PHE E:80 , GLN E:81 , VAL E:84 , ARG E:105 , ALA E:110 , PHE E:114 , GLU E:172	BINDING SITE FOR RESIDUE THM E 1402
13	BC4	SOFTWARE	GLU G:52 , VAL G:54 , MET G:69 , TYR G:70 , PHE G:80 , GLN G:81 , VAL G:84 , ALA G:110 , PHE G:114 , GLU G:172	BINDING SITE FOR RESIDUE THM G 1403
14	BC5	SOFTWARE	GLU F:52 , LEU F:66 , MET F:69 , TYR F:70 , PHE F:80 , GLN F:81 , VAL F:84 , ARG F:105 , ALA F:110 , PHE F:114 , GLU F:172	BINDING SITE FOR RESIDUE THM F 1404
15	BC6	SOFTWARE	GLU C:52 , TRP C:57 , LEU C:66 , MET C:69 , TYR C:70 , PHE C:80 , GLN C:81 , VAL C:84 , ALA C:110 , PHE C:114 , GLU C:172 , HOH C:1428	BINDING SITE FOR RESIDUE THM C 1405
16	BC7	SOFTWARE	GLU B:52 , LEU B:66 , MET B:69 , TYR B:70 , PHE B:80 , GLN B:81 , VAL B:84 , ARG B:105 , ALA B:110 , PHE B:114 , GLU B:172 , HOH B:1409 , HOH B:1420	BINDING SITE FOR RESIDUE THM B 1406
17	BC8	SOFTWARE	GLU H:52 , MET H:69 , TYR H:70 , PHE H:80 , GLN H:81 , VAL H:84 , ARG H:105 , ALA H:110 , PHE H:114 , GLU H:172 , HOH H:1408 , HOH H:1449	BINDING SITE FOR RESIDUE THM H 1407

(no "SS Bond" information available for 1OT3)

(no "Cis Peptide Bond" information available for 1OT3)

(no "SAP(SNP)/Variant" information available for 1OT3)

(no "PROSITE Motif" information available for 1OT3)

(no "Exon" information available for 1OT3)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:197
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3a_ A: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3A00 A:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee.....hhhhhhhhhhhhh...eee..hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhh.........hhhhhhhhhhhhhhhhh........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 A  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201

Chain B from PDB  Type:PROTEIN  Length:192
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3b_ B: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3B00 B:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee....hhhhhhhhhh......eee..hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..-----.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 B  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQ-----CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |    201       
                                                                                                                                                                                                                194   200

Chain C from PDB  Type:PROTEIN  Length:197
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3c_ C: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3C00 C:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee.....hhhhhhhhhhhhh..eeee..hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh........eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 C  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201

Chain D from PDB  Type:PROTEIN  Length:191
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3d_ D: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3D00 D:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee.....hhhhhhhhhhhhh..eeee..hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.------.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 D  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH------CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191 |     201       
                                                                                                                                                                                                               193    200

Chain E from PDB  Type:PROTEIN  Length:192
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3e_ E: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3E00 E:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeee....hhhhhhhhhhhhh...eee..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..-----.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 E  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQ-----CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |    201       
                                                                                                                                                                                                                194   200

Chain F from PDB  Type:PROTEIN  Length:192
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3f_ F: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3F00 F:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee.....hhhhhhhh.......eeee..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..-----.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 F  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQ-----CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |    201       
                                                                                                                                                                                                                194   200

Chain G from PDB  Type:PROTEIN  Length:192
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3g_ G: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3G00 G:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee.....hhhhhhhhhhhhh..eeee..hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh........eeee...hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..-----.eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 G  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQ-----CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |    201       
                                                                                                                                                                                                                194   200

Chain H from PDB  Type:PROTEIN  Length:192
 aligned with DNK_DROME | Q9XZT6 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:197
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
            DNK_DROME    12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD 208
               SCOP domains d1ot3h_ H: Deoxyribonucleoside kinase                                                                                                                                                                 SCOP domains
               CATH domains 1ot3H00 H:12-208 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                 CATH domains
           Pfam domains (1) --------------------------------------------------------------------dNK-1ot3H01 H:80-208                                                                                                              Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------dNK-1ot3H02 H:80-208                                                                                                              Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------dNK-1ot3H03 H:80-208                                                                                                              Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------dNK-1ot3H04 H:80-208                                                                                                              Pfam domains (4)
           Pfam domains (5) --------------------------------------------------------------------dNK-1ot3H05 H:80-208                                                                                                              Pfam domains (5)
           Pfam domains (6) --------------------------------------------------------------------dNK-1ot3H06 H:80-208                                                                                                              Pfam domains (6)
           Pfam domains (7) --------------------------------------------------------------------dNK-1ot3H07 H:80-208                                                                                                              Pfam domains (7)
           Pfam domains (8) --------------------------------------------------------------------dNK-1ot3H08 H:80-208                                                                                                              Pfam domains (8)
         Sec.struct. author .........eeeeee.....hhhhhhhhhhhhh...eee..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..-----.eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ot3 H  12 TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQ-----CKVLVLDAD 208
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |    201       
                                                                                                                                                                                                                194   200

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: Nucleotide and nucleoside kinases (231)

Protein domain: Deoxyribonucleoside kinase (11)

Fruit fly (Drosophila melanogaster) [TaxId: 7227] (11)

1a	d1ot3a_	A:
1b	d1ot3b_	B:
1c	d1ot3c_	C:
1d	d1ot3d_	D:
1e	d1ot3e_	E:
1f	d1ot3f_	F:
1g	d1ot3g_	G:
1h	d1ot3h_	H:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Fruit fly (Drosophila melanogaster) (15)

1a	1ot3A00	A:12-208
1b	1ot3C00	C:12-208
1c	1ot3B00	B:12-208
1d	1ot3E00	E:12-208
1e	1ot3F00	F:12-208
1f	1ot3G00	G:12-208
1g	1ot3H00	H:12-208
1h	1ot3D00	D:12-208

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: dNK (33)

Drosophila melanogaster (Fruit fly) (13)

1a	dNK-1ot3H01	H:80-208
1b	dNK-1ot3H02	H:80-208
1c	dNK-1ot3H03	H:80-208
1d	dNK-1ot3H04	H:80-208
1e	dNK-1ot3H05	H:80-208
1f	dNK-1ot3H06	H:80-208
1g	dNK-1ot3H07	H:80-208
1h	dNK-1ot3H08	H:80-208

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (DNK_DROME | Q9XZT6)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0019136	deoxynucleoside kinase activity	Catalysis of the reaction: ATP + 2'-deoxynucleoside = ADP + 2'-deoxynucleoside 5'-phosphate.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0019206	nucleoside kinase activity	Catalysis of the reaction: ATP + nucleoside = ADP + nucleoside monophosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0004797	thymidine kinase activity	Catalysis of the reaction: ATP + thymidine = ADP + thymidine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0071897	DNA biosynthetic process	The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0006230	TMP biosynthetic process	The chemical reactions and pathways resulting in the formation of TMP, ribosylthymine monophosphate.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0006165	nucleoside diphosphate phosphorylation	The process of introducing a phosphate group into a nucleoside diphosphate to produce a nucleoside triphosphate.
	GO:0046939	nucleotide phosphorylation	The process of introducing one or more phosphate groups into a nucleotide to produce a phosphorylated nucleoside.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		THM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ot3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ot3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DNK_DROME \| Q9XZT6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.145
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DNK_DROME \| Q9XZT6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DNK_DROME \| Q9XZT6	:	1j90 1oe0 1zm7 1zmx 2jcs 2jj8 2vp0 2vp2 2vp4 2vp5 2vp6 2vp9 2vpp 2vqs

(no "Related Entries Specified in the PDB File" available for 1OT3)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 17)

Sites (17, 17)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File