|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1O0F) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (1, 2)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:124 36 46 56 66 76 86 96 106 116 126 136 146 RNAS1_BOVIN 27 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 150 SCOP domains d1o0fa_ A: Ribonuclease A (also ribonuclease B, S) SCOP domains CATH domains 1o0fA00 A:1-124 P-30 Protein CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------RNASE_P------------------------------------------------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: A:1-124 UniProt: 1-159 [INCOMPLETE] Transcript 1 1o0f A 1 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 124 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:124 aligned with RNAS1_BOVIN | P61823 from UniProtKB/Swiss-Prot Length:150 Alignment length:124 36 46 56 66 76 86 96 106 116 126 136 146 RNAS1_BOVIN 27 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 150 SCOP domains d1o0fb_ B: Ribonuclease A (also ribonuclease B, S) SCOP domains CATH domains 1o0fB00 B:1-124 P-30 Protein CATH domains Pfam domains (1) RnaseA-1o0fB01 B:1-121 --- Pfam domains (1) Pfam domains (2) RnaseA-1o0fB02 B:1-121 --- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------RNASE_P------------------------------------------------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: B:1-124 UniProt: 1-159 [INCOMPLETE] Transcript 1 1o0f B 1 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV 124 10 20 30 40 50 60 70 80 90 100 110 120
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (RNAS1_BOVIN | P61823)
|
|
|
|
|
|
|