|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)
Asymmetric Unit (3, 5)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1NZV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NZV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NZV) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1NZV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:101 aligned with SRC_RSVSA | P00524 from UniProtKB/Swiss-Prot Length:526 Alignment length:103 154 164 174 184 194 204 214 224 234 244 SRC_RSVSA 145 AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 SCOP domains d1nzva_ A: c-src tyrosine kinase SCOP domains CATH domains 1nzvA00 A:147-249 SHC Adaptor Prote in CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---SH2 PDB: A:150-247 UniProt: 148-245 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1nzv A 147 AEEWYFGKITRRESERLLLNPENPRGTFLVRESET--GAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 249 156 166 176 | 186 196 206 216 226 236 246 181 | 184 Chain B from PDB Type:PROTEIN Length:103 aligned with SRC_RSVSA | P00524 from UniProtKB/Swiss-Prot Length:526 Alignment length:103 154 164 174 184 194 204 214 224 234 244 SRC_RSVSA 145 AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 SCOP domains d1nzvb_ B: c-src tyrosine kinase SCOP domains CATH domains 1nzvB00 B:251-353 SHC Adaptor Protein CATH domains Pfam domains (1) ---SH2-1nzvB01 B:254-336 ----------------- Pfam domains (1) Pfam domains (2) ---SH2-1nzvB02 B:254-336 ----------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---SH2 PDB: B:254-351 UniProt: 148-245 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1nzv B 251 AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 353 260 270 280 290 300 310 320 330 340 350
Chain C from PDB Type:PROTEIN Length:8
SCOP domains -------- SCOP domains
CATH domains -------- CATH domains
Pfam domains -------- Pfam domains
SAPs(SNPs) -------- SAPs(SNPs)
PROSITE -------- PROSITE
Transcript -------- Transcript
1nzv C 498 PQyIyVPA 505
| |
500-PTR
502-PTR
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SRC_RSVSA | P00524)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|