![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1IS0) |
(no "Cis Peptide Bond" information available for 1IS0) |
(no "SAP(SNP)/Variant" information available for 1IS0) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1IS0) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:102 aligned with SRC_RSVSA | P00524 from UniProtKB/Swiss-Prot Length:526 Alignment length:102 155 165 175 185 195 205 215 225 235 245 SRC_RSVSA 146 EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 SCOP domains d1is0a_ A: c-src tyrosine kinase SCOP domains CATH domains 1is0A00 A:146-247 SHC Adaptor Protein CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --SH2 PDB: A:148-245 UniProt: 148-245 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 1is0 A 146 EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 155 165 175 185 195 205 215 225 235 245 Chain B from PDB Type:PROTEIN Length:102 aligned with SRC_RSVSA | P00524 from UniProtKB/Swiss-Prot Length:526 Alignment length:102 155 165 175 185 195 205 215 225 235 245 SRC_RSVSA 146 EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 SCOP domains d1is0b_ B: c-src tyrosine kinase SCOP domains CATH domains 1is0B00 B:146-247 SHC Adaptor Protein CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --SH2 PDB: B:148-245 UniProt: 148-245 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 1is0 B 146 EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT 247 155 165 175 185 195 205 215 225 235 245 Chain C from PDB Type:PROTEIN Length:4 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1is0 C 252 xEEI 255 | 252-AY0 Chain D from PDB Type:PROTEIN Length:4 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1is0 D 352 xEEI 355 | | 352-AY0
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1IS0) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SRC_RSVSA | P00524)
|
|
|
|
|
|
|