1NBI - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF R175K MUTATED GLYCINE N-METHYLTRANSFERASE COMPLEXED WITH S-ADENOSYLMETHIONINE, R175K:SAM.

Authors :   Y. Takata, F. Takusagawa

Date :   02 Dec 02 (Deposition) - 04 Mar 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Methyltransferase, Glycine N-Methyltransferase, Catalytic Mechanism, Dynamical Catalysis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Takata, Y. Huang, J. Komoto, T. Yamada, K. Konishi, H. Ogawa, T. Gomi, M. Fujioka, F. Takusagawa
Catalytic Mechanism Of Glycine N-Methyltransferase
Biochemistry V. 42 8394 2003
PubMed-ID: 12859184 | Reference-DOI: 10.1021/BI034245A
(for further references see the PDB file header)

Molecule 1 - GLYCINE N-METHYLTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.1.1.20
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	GNMT
	Mutation	:	YES
	Organ	:	LIVER
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	FOLATE-BINDING PROTEIN, GNMT

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SAM	4	Ligand/Ion	S-ADENOSYLMETHIONINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:21 , TRP A:30 , ILE A:34 , ARG A:40 , ALA A:64 , GLY A:66 , VAL A:69 , ASP A:85 , ALA A:86 , SER A:87 , MET A:90 , ALA A:115 , ASN A:116 , TRP A:117 , LEU A:136 , SER A:139 , HIS A:142 , TYR A:194	BINDING SITE FOR RESIDUE SAM A 293
2	AC2	SOFTWARE	TYR B:21 , TRP B:30 , ILE B:34 , ARG B:40 , ALA B:64 , GLY B:66 , VAL B:69 , ASP B:85 , ALA B:86 , SER B:87 , MET B:90 , ALA B:115 , ASN B:116 , TRP B:117 , LEU B:136 , SER B:139 , HIS B:142 , TYR B:194 , HOH B:5048	BINDING SITE FOR RESIDUE SAM B 1293
3	AC3	SOFTWARE	TYR C:21 , TRP C:30 , ILE C:34 , ARG C:40 , ALA C:64 , THR C:67 , ASP C:85 , ALA C:86 , SER C:87 , MET C:90 , ALA C:115 , ASN C:116 , TRP C:117 , LEU C:136 , GLY C:137 , SER C:139 , HIS C:142	BINDING SITE FOR RESIDUE SAM C 2293
4	AC4	SOFTWARE	TRP D:30 , ILE D:34 , ARG D:40 , ALA D:64 , THR D:67 , ASP D:85 , ALA D:86 , SER D:87 , MET D:90 , ALA D:115 , ASN D:116 , TRP D:117 , LEU D:136 , SER D:139 , HIS D:142 , TYR D:194	BINDING SITE FOR RESIDUE SAM D 3293

(no "SS Bond" information available for 1NBI)

(no "Cis Peptide Bond" information available for 1NBI)

(no "SAP(SNP)/Variant" information available for 1NBI)

(no "PROSITE Motif" information available for 1NBI)

Asymmetric/Biological Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000022307	1	ENSRNOE00000155790	chr9:10127092-10127301	210	GNMT_RAT	1-69	69	4	A:18-68 B:18-68 C:18-68 D:18-68	51 51 51 51
1.2	ENSRNOT00000022307	2	ENSRNOE00000156216	chr9:10128745-10128872	128	GNMT_RAT	69-112	44	4	A:68-111 B:68-111 C:68-111 D:68-111	44 44 44 44
1.3	ENSRNOT00000022307	3	ENSRNOE00000156616	chr9:10129429-10129539	111	GNMT_RAT	112-149	38	4	A:111-148 B:111-148 C:111-148 D:111-148	38 38 38 38
1.4	ENSRNOT00000022307	4	ENSRNOE00000157087	chr9:10129733-10129875	143	GNMT_RAT	149-196	48	4	A:148-195 B:148-195 C:148-195 D:148-195	48 48 48 48
1.5	ENSRNOT00000022307	5	ENSRNOE00000157394	chr9:10129963-10130084	122	GNMT_RAT	197-237	41	4	A:196-236 B:196-236 C:196-236 D:196-236	41 41 41 41
1.6	ENSRNOT00000022307	6	ENSRNOE00000157770	chr9:10130171-10130444	274	GNMT_RAT	237-293	57	4	A:236-292 B:236-292 C:236-292 D:236-292	57 57 57 57

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:275
 aligned with GNMT_RAT | P13255 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:275
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288     
             GNMT_RAT    19 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 293
               SCOP domains d1nbia_ A: Glycine N-methyltransferase                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1nbiA01         1nbiA02 A:34-175,A:243-292 Vaccinia Virus protein VP39                                                                                        1nbiA01 A:18-33,A:176-242                                          1nbiA02 A:34-175,A:243-292                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh..hhhhhh.eeee.hhhhhhhhh.....eeeeee...hhhhh......hhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhh...............eeeeeeeeeee..eeeeeeeeeee.............eeeeeee...hhhhhhhhhhhhh...eeeee................eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:18-68 UniProt: 1-69 [INCOMPLETE]  ------------------------------------------Exon 1.3  PDB: A:111-148              -----------------------------------------------Exon 1.5  PDB: A:196-236 UniProt: 197-237-------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.2  PDB: A:68-111 UniProt: 69-112     ------------------------------------Exon 1.4  PDB: A:148-195 UniProt: 149-196       ----------------------------------------Exon 1.6  PDB: A:236-292 UniProt: 237-293                 Transcript 1 (2)
                 1nbi A  18 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 292
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Chain B from PDB  Type:PROTEIN  Length:275
 aligned with GNMT_RAT | P13255 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:275
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288     
             GNMT_RAT    19 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 293
               SCOP domains d1nbib_ B: Glycine N-methyltransferase                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1nbiB01         1nbiB02 B:34-175,B:243-292 Vaccinia Virus protein VP39                                                                                        1nbiB01 B:18-33,B:176-242                                          1nbiB02 B:34-175,B:243-292                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh..hhhhhh.eeee.hhhhhhhhh.....eeeeee...hhhhh......hhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhh...............eeeeeeeeeee..eeeeeeeeeee.............eeeeeee...hhhhhhhhhhhhh...eeeeee...............eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:18-68 UniProt: 1-69 [INCOMPLETE]  ------------------------------------------Exon 1.3  PDB: B:111-148              -----------------------------------------------Exon 1.5  PDB: B:196-236 UniProt: 197-237-------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.2  PDB: B:68-111 UniProt: 69-112     ------------------------------------Exon 1.4  PDB: B:148-195 UniProt: 149-196       ----------------------------------------Exon 1.6  PDB: B:236-292 UniProt: 237-293                 Transcript 1 (2)
                 1nbi B  18 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 292
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Chain C from PDB  Type:PROTEIN  Length:275
 aligned with GNMT_RAT | P13255 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:275
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288     
             GNMT_RAT    19 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 293
               SCOP domains d1nbic_ C: Glycine N-methyltransferase                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1nbiC01         1nbiC02 C:34-175,C:243-292 Vaccinia Virus protein VP39                                                                                        1nbiC01 C:18-33,C:176-242                                          1nbiC02 C:34-175,C:243-292                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh..hhhhhh.eeee.hhhhhhhhh.....eeeeee...hhhhh......hhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhh...................eeeeee..eeeeeeeeeee.............eeeeeee...hhhhhhhhhhhhh......eee...............eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:18-68 UniProt: 1-69 [INCOMPLETE]  ------------------------------------------Exon 1.3  PDB: C:111-148              -----------------------------------------------Exon 1.5  PDB: C:196-236 UniProt: 197-237-------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.2  PDB: C:68-111 UniProt: 69-112     ------------------------------------Exon 1.4  PDB: C:148-195 UniProt: 149-196       ----------------------------------------Exon 1.6  PDB: C:236-292 UniProt: 237-293                 Transcript 1 (2)
                 1nbi C  18 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 292
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Chain D from PDB  Type:PROTEIN  Length:275
 aligned with GNMT_RAT | P13255 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:275
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288     
             GNMT_RAT    19 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 293
               SCOP domains d1nbid_ D: Glycine N-methyltransferase                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1nbiD01         1nbiD02 D:34-175,D:243-292 Vaccinia Virus protein VP39                                                                                        1nbiD01 D:18-33,D:176-242                                          1nbiD02 D:34-175,D:243-292                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh..hhhhhh.eeee.hhhhhhhhh.....eeeeee...hhhhh......hhhhhhhhhhhhh.eeeeeeeeeeeehhhhhhhhh...................eeeeee..eeeeeeeeeee.............eeeeeee...hhhhhhhhhhhhh......eee...............eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:18-68 UniProt: 1-69 [INCOMPLETE]  ------------------------------------------Exon 1.3  PDB: D:111-148              -----------------------------------------------Exon 1.5  PDB: D:196-236 UniProt: 197-237-------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.2  PDB: D:68-111 UniProt: 69-112     ------------------------------------Exon 1.4  PDB: D:148-195 UniProt: 149-196       ----------------------------------------Exon 1.6  PDB: D:236-292 UniProt: 237-293                 Transcript 1 (2)
                 1nbi D  18 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG 292
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: S-adenosyl-L-methionine-dependent methyltransferases (533)

Superfamily: S-adenosyl-L-methionine-dependent methyltransferases (533)

Family: Glycine N-methyltransferase (16)

Protein domain: Glycine N-methyltransferase (16)

Norway rat (Rattus norvegicus) [TaxId: 10116] (12)

1a	d1nbia_	A:
1b	d1nbib_	B:
1c	d1nbic_	C:
1d	d1nbid_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Glycine N-methyltransferase; chain A, domain 1 (14)

Homologous Superfamily: Glycine N-methyltransferase, chain A, domain 1 (14)

Norway rat (Rattus norvegicus) (9)

1a	1nbiA01	A:18-33,A:176-242
1b	1nbiB01	B:18-33,B:176-242
1c	1nbiC01	C:18-33,C:176-242
1d	1nbiD01	D:18-33,D:176-242

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Vaccinia Virus protein VP39 (378)

Norway rat (Rattus norvegicus) (23)

2a	1nbiA02	A:34-175,A:243-292
2b	1nbiB02	B:34-175,B:243-292
2c	1nbiC02	C:34-175,C:243-292
2d	1nbiD02	D:34-175,D:243-292

(no "Pfam Domain" information available for 1NBI)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (GNMT_RAT | P13255)

molecular function
	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity	Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
	GO:0005542	folic acid binding	Interacting selectively and non-covalently with folic acid, pteroylglutamic acid. Folic acid is widely distributed as a member of the vitamin B complex and is essential for the synthesis of purine and pyrimidines.
	GO:0017174	glycine N-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + glycine = S-adenosyl-L-homocysteine + sarcosine.
	GO:0016594	glycine binding	Interacting selectively and non-covalently with glycine, aminoethanoic acid.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0098603	selenol Se-methyltransferase activity	Catalysis of the reaction: R + Se-Adenosylselenomethionine => CH3-R + Se-Adenosyl-L-selenohomocysteine.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0046498	S-adenosylhomocysteine metabolic process	The chemical reactions and pathways involving S-adenosylhomocysteine; the L-enantiomer is formed from S-adenosylmethionine and is a strong inhibitor of S-adenosylmethionine-mediated methylation reactions. It can be cleaved to form adenosine and homocysteine.
	GO:0046500	S-adenosylmethionine metabolic process	The chemical reactions and pathways involving S-adenosylmethionine, S-(5'-adenosyl)-L-methionine, an important intermediate in one-carbon metabolism.
	GO:0046655	folic acid metabolic process	The chemical reactions and pathways involving folic acid, pteroylglutamic acid. Folic acid is widely distributed as a member of the vitamin B complex and is essential for the synthesis of purine and pyrimidines.
	GO:0006544	glycine metabolic process	The chemical reactions and pathways involving glycine, aminoethanoic acid.
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
	GO:0051262	protein tetramerization	The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
	GO:1901052	sarcosine metabolic process	The chemical reactions and pathways involving sarcosine.
	GO:0001887	selenium compound metabolic process	The chemical reactions and pathways involving compounds that contain selenium, such as selenocysteine.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SAM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nbi)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1nbi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GNMT_RAT \| P13255
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.20
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GNMT_RAT \| P13255
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GNMT_RAT \| P13255	:	1bhj 1d2c 1d2g 1d2h 1kia 1nbh 1xva 2idj 2idk 3thr 3ths

(no "Related Entries Specified in the PDB File" available for 1NBI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (19, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File