|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1MYK) |
(no "Site" information available for 1MYK) |
(no "SS Bond" information available for 1MYK) |
(no "Cis Peptide Bond" information available for 1MYK) |
(no "SAP(SNP)/Variant" information available for 1MYK) |
(no "PROSITE Motif" information available for 1MYK) |
(no "Exon" information available for 1MYK) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:47 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:47 15 25 35 45 RARC_BPP22 6 KMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG 52 SCOP domains d1myka_ A: Arc repressor SCOP domains CATH domains 1mykA00 A:6-52 Met repressor-like CATH domains Pfam domains ----------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------- PROSITE Transcript ----------------------------------------------- Transcript 1myk A 6 KMLQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG 52 15 25 35 45 Chain B from PDB Type:PROTEIN Length:45 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:45 15 25 35 45 RARC_BPP22 6 KMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR 50 SCOP domains d1mykb_ B: Arc repressor SCOP domains CATH domains 1mykB00 B:6-50 Met repressor-like CATH domains Pfam domains (1) Arc-1mykB01 B:6-50 Pfam domains (1) Pfam domains (2) Arc-1mykB02 B:6-50 Pfam domains (2) SAPs(SNPs) --------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------- PROSITE Transcript --------------------------------------------- Transcript 1myk B 6 KMLQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR 50 15 25 35 45
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (RARC_BPP22 | P03050)
|
|
|
|
|
|
|