Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  TWO HOMOLOGOUS RAT CELLULAR RETINOL-BINDING PROTEINS DIFFER IN LOCAL STRUCTURE AND FLEXIBILITY
 
Authors :  J. Lu, D. P. Cistola, E. Li
Date :  01 Oct 02  (Deposition) - 29 Jul 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (22x)
Keywords :  Beta-Barrel, Helix-Turn-Helix, Vitamin A, Retinol-Binding, Transport, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Lu, D. P. Cistola, E. Li
Two Homologous Rat Cellular Retinol-Binding Proteins Differ In Local Conformational Flexibility.
J. Mol. Biol. V. 330 799 2003
PubMed-ID: 12850148  |  Reference-DOI: 10.1016/S0022-2836(03)00629-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CELLULAR RETINOL-BINDING PROTEIN I, APO
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMON CRBP I
    Expression System Strain: JM101
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: RBP1 OR RBP-1
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116

 Structural Features

(-) Chains, Units

  
NMR Structure (22x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MX7)

(-) Sites  (0, 0)

(no "Site" information available for 1MX7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MX7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MX7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MX7)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FABPPS00214 Cytosolic fatty-acid binding proteins signature.RET1_RAT7-24  1A:6-23

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000186221ENSRNOE00000131422chr8:103605870-103606037168RET1_RAT1-25251A:1-2424
1.2ENSRNOT000000186222ENSRNOE00000131736chr8:103606421-103606599179RET1_RAT25-84601A:24-8360
1.3ENSRNOT000000186223ENSRNOE00000132019chr8:103625505-103625606102RET1_RAT85-118341A:84-11734
1.4ENSRNOT000000186224ENSRNOE00000132311chr8:103627144-103627390247RET1_RAT119-135171A:118-13417

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:134
 aligned with RET1_RAT | P02696 from UniProtKB/Swiss-Prot  Length:135

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
             RET1_RAT     2 PVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH 135
               SCOP domains d1mx7a_ A: Cellular retinol-binding protein II (CRBP)                                                                                  SCOP domains
               CATH domains 1mx7A00 A:1-134  [code=2.40.128.20, no name defined]                                                                                   CATH domains
               Pfam domains ----Lipocalin-1mx7A01 A:5-133                                                                                                        - Pfam domains
         Sec.struct. author ......eeeeeeee.hhhhhhh....hhhhhh.....eeeeeeee..eeeeeeee...eeeeeee..eeeeee........eeeeeeee..eeeeee......eeeeeeee..eeeeeee...eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----FABP  PDB: A:6-23 --------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-24   -----------------------------------------------------------Exon 1.3  PDB: A:84-117           Exon 1.4          Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.2  PDB: A:24-83 UniProt: 25-84                       --------------------------------------------------- Transcript 1 (2)
                 1mx7 A   1 PVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Calycin (163)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)
Chain A   (RET1_RAT | P02696)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0016918    retinal binding    Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
    GO:0019841    retinol binding    Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0030852    regulation of granulocyte differentiation    Any process that modulates the frequency, rate or extent of granulocyte differentiation.
    GO:0033189    response to vitamin A    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin A stimulus.
    GO:0002138    retinoic acid biosynthetic process    The chemical reactions and pathways resulting in the biosynthesis of retinoic acid, one of the three components that makes up vitamin A.
    GO:0042573    retinoic acid metabolic process    The chemical reactions and pathways involving retinoic acid, one of the three components that makes up vitamin A.
    GO:0042572    retinol metabolic process    The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0006776    vitamin A metabolic process    The chemical reactions and pathways involving any of the vitamin A compounds, retinol, retinal (retinaldehyde) and retinoic acid, all of which are derivatives of beta-carotene.
cellular component
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mx7)
 
  Sites
(no "Sites" information available for 1mx7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mx7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mx7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RET1_RAT | P02696
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RET1_RAT | P02696
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RET1_RAT | P02696: 1crb 1jbh 1kgl 1mx8

(-) Related Entries Specified in the PDB File

1mx8 SAME PROTEIN, COMPLEXED WITH RETINOL