1LTX - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF RAB ESCORT PROTEIN-1 IN COMPLEX WITH RAB GERANYLGERANYL TRANSFERASE AND ISOPRENOID

Authors :   O. Pylypenko, A. Rak, R. Reents, A. Niculae, N. H. Thoma, H. Waldmann, I. Schlichting, R. S. Goody, K. Alexandrov

Date :   21 May 02 (Deposition) - 21 May 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym./Biol. Unit : A,B,P,R

Keywords :   Rab Prenylation, Prenyltransferase, Lucine-Rich Repeats, Post-Translational Modification, Transferase/Protein Binding Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   O. Pylypenko, A. Rak, R. Reents, A. Niculae, V. Sidorovitch, M. D. Cioaca, E. Bessolitsyna, N. H. Thoma, H. Waldmann, I. Schlichting, R. S. Goody, K. Alexandrov
Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyltransferase
Mol. Cell V. 11 483 2003
PubMed-ID: 12620235 | Reference-DOI: 10.1016/S1097-2765(03)00044-3
(for further references see the PDB file header)

Molecule 1 - RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT
	Chains	:	A
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGATEV
	Expression System Strain	:	BL21(DE3) RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116

Molecule 2 - RAB GERANYLGERANYLTRANSFERASE BETA SUBUNIT
	Chains	:	B
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET30A
	Expression System Strain	:	BL21(DE3) RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	GERANYLGERANYL TRANSFERASE TYPE II BETA SUBUNIT

Molecule 3 - RAB ESCORT PROTEIN 1
	Chains	:	R
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF21
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	PBLUEBAC
	Expression System Vector Type	:	BACULOVIRUS
	Mutation	:	YES
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	RAB PROTEINS GERANYLGERANYLTRANSFERASE COMPONENT A 1

Molecule 4 - AAAA
	Chains	:	P
	Engineered	:	YES
	Other Details	:	PUTATIVE PEPTIDE.
	Synthetic	:	YES

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	P	R

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 3)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION
2	FAR	1	Ligand/Ion	FARNESYL
3	ZN	1	Ligand/Ion	ZINC ION

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:238 , CYS B:240 , HIS B:290	BINDING SITE FOR RESIDUE ZN B 900
2	AC2	SOFTWARE	TYR R:234 , GLY R:580 , ASN R:581 , HOH R:916	BINDING SITE FOR RESIDUE CL R 901
3	AC3	SOFTWARE	TYR A:107 , TYR B:51 , GLN B:103 , ARG B:144 , TYR B:195 , ALA P:9 , ALA P:11 , ALA P:12	BINDING SITE FOR RESIDUE FAR P 1428

(no "SS Bond" information available for 1LTX)

(no "Cis Peptide Bond" information available for 1LTX)

(no "SAP(SNP)/Variant" information available for 1LTX)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PFTA	PS51147	Protein prenyltransferases alpha subunit repeat profile.	PGTA_RAT	44-78 88-122 124-158 159-193 207-241 363-397	6	A:44-78 A:88-122 A:124-158 A:159-193 A:207-241 A:363-397

Asymmetric/Biological Unit (15, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000048455	1	ENSRNOE00000431461	chr15:33868619-33868585	35	PGTA_RAT	-	0	0	-	-
1.2	ENSRNOT00000048455	2	ENSRNOE00000442687	chr15:33868298-33868241	58	PGTA_RAT	1-1	1	0	-	-
1.3	ENSRNOT00000048455	3	ENSRNOE00000336091	chr15:33868107-33867997	111	PGTA_RAT	2-38	37	1	A:24-38	15
1.4	ENSRNOT00000048455	4	ENSRNOE00000290128	chr15:33867677-33867553	125	PGTA_RAT	39-80	42	1	A:39-80	42
1.5	ENSRNOT00000048455	5	ENSRNOE00000303229	chr15:33867378-33867191	188	PGTA_RAT	80-143	64	1	A:80-143	64
1.6	ENSRNOT00000048455	6	ENSRNOE00000290397	chr15:33866934-33866731	204	PGTA_RAT	143-211	69	1	A:143-211 (gaps)	69
1.7	ENSRNOT00000048455	7	ENSRNOE00000327073	chr15:33866284-33866201	84	PGTA_RAT	211-239	29	1	A:211-239	29
1.8	ENSRNOT00000048455	8	ENSRNOE00000288887	chr15:33866112-33866030	83	PGTA_RAT	239-266	28	1	A:239-266 (gaps)	28
1.9	ENSRNOT00000048455	9	ENSRNOE00000339199	chr15:33865939-33865838	102	PGTA_RAT	267-300	34	1	A:267-300	34
1.10	ENSRNOT00000048455	10	ENSRNOE00000352360	chr15:33865732-33865627	106	PGTA_RAT	301-336	36	1	A:301-336	36
1.11	ENSRNOT00000048455	11	ENSRNOE00000303916	chr15:33865535-33865484	52	PGTA_RAT	336-353	18	1	A:336-353	18
1.12	ENSRNOT00000048455	12	ENSRNOE00000357522	chr15:33865353-33865265	89	PGTA_RAT	353-383	31	1	A:353-383	31
1.13	ENSRNOT00000048455	13	ENSRNOE00000294255	chr15:33865148-33865060	89	PGTA_RAT	383-412	30	1	A:383-412	30
1.14	ENSRNOT00000048455	14	ENSRNOE00000306932	chr15:33864791-33864675	117	PGTA_RAT	413-451	39	1	A:413-451	39
1.15	ENSRNOT00000048455	15	ENSRNOE00000363642	chr15:33864038-33863925	114	PGTA_RAT	452-489	38	1	A:452-489	38
1.16	ENSRNOT00000048455	16	ENSRNOE00000281487	chr15:33863675-33863588	88	PGTA_RAT	490-519	30	1	A:490-519	30
1.17	ENSRNOT00000048455	17	ENSRNOE00000307031	chr15:33862501-33862275	227	PGTA_RAT	519-567	49	1	A:519-567	49

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:536
 aligned with PGTA_RAT | Q08602 from UniProtKB/Swiss-Prot  Length:567

    Alignment length:544
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563    
             PGTA_RAT    24 KLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRAEPHDVLCCVHVSREEACLSVCFSRPLTVGSRMGTLLLMVDEAPLSVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTGSDSQKECVLLKDRPECWCRDSATDEQLFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSILT 567
               SCOP domains d1ltxa1 A:24-241,A:351-443 Rab geranylgeranyltransferase alpha-subunit, N-terminal domain                                                                                                                                   d1ltxa2 A:244-350 Rab geranylgeranyltransferase alpha-subunit, insert domain                               d1ltxa1 A:24-241,A:351-443 Rab geranylgeranyltransferase alpha-subunit, N-terminal domain    d1ltxa3 A:444-567 Rab geranylgeranyltransferase alpha-subunit, C-terminal domain                                             SCOP domains
               CATH domains 1ltxA01 A:24-241,A:353-429  [code=1.25.40.120, no name defined]                                                                                                                                                             1ltxA02 A:244-344  [code=2.60.40.1130, no name defined]                                              --------1ltxA01 A:24-241,A:353-429  [code=1.25.40.120, no name defined]              -1ltxA03 A:431-565 Ribonuclease Inhibitor                                                                                               -- CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ltxA02 A:210-240         ---RabGGT_insert-1ltxA07 A:244-346                                                                        ----------------------------------------------------------------------------------------------------------------------LRR_1-1ltxA01        ---------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ltxA03 A:210-240         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ltxA04 A:210-240         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ltxA05 A:210-240         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1ltxA06 A:210-240         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (5)
         Sec.struct. author ....hhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....------....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh......--.eeeeeee....eeeeeeeeee........eeeee..................eeeeeee.hhhhh.....eeeeeeee.....eeeeeee....eeeee.............hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..eee..........hhhhh....eee.........hhhhhhh....eee........hhhhh......eee.......hhhhhhhhhhh....eee...hhhhhh.hhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------PFTA  PDB: A:44-78 UniProt: 44-78  ---------PFTA  PDB: A:88-122 UniProt: 88-122-PFTA  PDB: A:124-158               PFTA  PDB: A:159-193               -------------PFTA  PDB: A:207-241               -------------------------------------------------------------------------------------------------------------------------PFTA  PDB: A:363-397               -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3       Exon 1.4  PDB: A:39-80 UniProt: 39-80     --------------------------------------------------------------Exon 1.6  PDB: A:143-211 (gaps) UniProt: 143-211                     ---------------------------Exon 1.8 UniProt: 239-266   Exon 1.9  PDB: A:267-300          Exon 1.10  PDB: A:301-336           ----------------Exon 1.12  PDB: A:353-383      -----------------------------Exon 1.14  PDB: A:413-451              Exon 1.15  PDB: A:452-489             Exon 1.16  PDB: A:490-519     ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.5  PDB: A:80-143 UniProt: 80-143                         -------------------------------------------------------------------Exon 1.7  PDB: A:211-239     ------------------------------------------------------------------------------------------------Exon 1.11         -----------------------------Exon 1.13  PDB: A:383-412     ----------------------------------------------------------------------------------------------------------Exon 1.17  PDB: A:519-567 UniProt: 519-567        Transcript 1 (2)
                 1ltx A  24 KLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHP------QGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRAEP--VLCCVHVSREEACLSVCFSRPLTVGSRMGTLLLMVDEAPLSVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTGSDSQKECVLLKDRPECWCRDSATDEQLFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSILT 567
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193      |203       213       223       233       | -|      253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563    
                                                                                                                                                                                                   193    200                                      241  |                                                                                                                                                                                                                                                                                                                                   
                                                                                                                                                                                                                                                      244

Chain B from PDB  Type:PROTEIN  Length:318
 aligned with PGTB2_RAT | Q08603 from UniProtKB/Swiss-Prot  Length:331

    Alignment length:326
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325      
            PGTB2_RAT     6 KDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS 331
               SCOP domains d1ltxb_  B: Rab geranylgera       nyltransferase, beta subunit                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ltxB00  B:6-331  [code=1.5       0.10.20, no name defined]                                                                                                                                                                                                                                                                            CATH domains
           Pfam domains (1) ------------------------------------------------------------------Prenyltrans_2-1ltxB03 B:72-183                                                                                  --------------------------------------------------------------------------Prenyltrans-1ltxB01 B:258-302                ----------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Prenyltrans-1ltxB02 B:258-302                ----------------------------- Pfam domains (2)
         Sec.struct. author ........-....hhhhhhhhhhhh..-------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh......hhhhhhhhhhh................hhhhhhhhhhhhhh.......hhhhhhhhhhhh...............hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.......ee......eehhhhhhhhhhhhhhh.............hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ltx B   6 KDVTIKSD-PDTLLLEKHADYIASYGS-------CMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS 331
                                   |15        25      |  -    |   45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325      
                                  13 |               32      40                                                                                                                                                                                                                                                                                                   
                                    15

Chain P from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1ltx P   9 AAAA  12

Chain R from PDB  Type:PROTEIN  Length:494
 aligned with RAE1_RAT | P37727 from UniProtKB/Swiss-Prot  Length:650

    Alignment length:613
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611   
             RAE1_RAT     2 ADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSCLPTAVEPLSMGSCEIPAEQSQCPGPESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFNIDLVSQLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEHPDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMTSETTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTCSRVQYRQISRAVLITDGSVLKTDADQQVSILAVPAEEPGSFGVRVIELCSSTMTCMKGTYLVHLTCMSSKTAREDLERVVQKLFTPYTEIEAENEQVEKPRLLWALYFNMRDSSDISRDCYNDLPSNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFCPAPPNPEDIVLD 614
               SCOP domains d1ltxr1 R:2-444,R:558-614 Rab escort protein 1                                                                                                                                                                                                                                                                                                                                                                                                             d1ltxr2 R:445-557 Rab escort protein 1                                                                           d1ltxr1 R:2-444,R:558-614 Rab escort protein       1      SCOP domains
               CATH domains 1ltxR01 R:2-92,R:370-446,R:554-601  [code=3.50.50.60, no name de    fined]                 1ltxR02 R:93-27                                                                                                     0,R:447-553 Guanine Nucleotide Dissociation Inhibitor, domain 1ltxR03 R:271-369 Guanine Nucleotide Dissociation Inhibitor, domain 1                              1ltxR01 R:2-92,R:370-446,R:554-601  [code=3.50.50.60, no name defined]       1ltxR02 R:93-270,R:447-553 Guanine Nucleotide Dissociation Inhibitor, domain 2                             1ltxR01 R:2-92,R:370-446,R:554-601                    ------- CATH domains
           Pfam domains (1) ----------------------------------------------------------------    --------------------------------------                                                                                                     GDI-1ltxR01 R:209-542                                                                                                                                                                                                                                                                                                                         -----------------------------------------------------------      ------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------    --------------------------------------                                                                                                     GDI-1ltxR02 R:209-542                                                                                                                                                                                                                                                                                                                         -----------------------------------------------------------      ------- Pfam domains (2)
         Sec.struct. author .........eeee..hhhhhhhhhhhhhh...eeee......hhhh.eehhhhhhhhhhh....----....hhhhhh...eeeee.......eeeeeeee.....-----------------------------------------------------------------------------------------------------....hhhhhhhhhhhh.ee.....ee..hhhhhhhhhhhhhhhh.eeeeeeeeeee..eeee...hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhh......--..hhhhhhhhhhhhhh.........eeee....hhhhhhhhhhhhhh..eee....eeeeeee.....eeeeee....eee..eeeee.hhh..........eeeeeeeeee............eeeeee.........eeeeeehhhhh......eeeeeeee...hhhhhhhhhhhhhhee.....------...eeeeeeeeeeee....hhhhh......eeee........hhhhhhhhhhhhhhhh.....------....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ltx R   2 ADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQEN----TENSMWQEQILENEEAIPLSSKDKTIQHVEVFCYASQD-----------------------------------------------------------------------------------------------------KNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEHPDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMTS--TSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTCSRVQYRQISRAVLITDGSVLKTDADQQVSILTVPAEEPGSFAVRVIELCSSTMTCMKGTYLVHLTCMSSKTAREDLERVVQKLFTPYTEIE------EKPRLLWALYFNMRDSSDISRDCYNDLPSNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDF------PEDIVLD 614
                                    11        21        31        41        51        61   |    71        81        91       101     |   -         -         -         -         -         -         -         -         -         -       211       221       231       241       251       261       271       281       291       301       311       321       331       341|  |   351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531|      541       551       561       571       581       591       601      |611   
                                                                                          65   70                                  107                                                                                                   209                                                                                                                                  342  |                                                                                                                                                                                        532    539                                                           601    608      
                                                                                                                                                                                                                                                                                                                                                                                 345

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 6_Hairpin (120)

Family: Prenyltrans (49)

Rattus norvegicus (Rat) (31)

1a	Prenyltrans-1ltxB01	B:258-302
1b	Prenyltrans-1ltxB02	B:258-302

Family: Prenyltrans_2 (47)

Rattus norvegicus (Rat) (31)

Prenyltrans_2-1ltxB03

B:72-183

Clan: LRR (77)

Family: LRR_1 (20)

Rattus norvegicus (Rat) (1)

LRR_1-1ltxA01

A:465-485

Clan: NADP_Rossmann (1239)

Family: GDI (6)

Rattus norvegicus (Rat) (3)

4a	GDI-1ltxR01	R:209-542
4b	GDI-1ltxR02	R:209-542

Clan: no clan defined [family: PPTA] (36)

Family: PPTA (36)

Rattus norvegicus (Rat) (31)

5a	PPTA-1ltxA02	A:210-240
5b	PPTA-1ltxA03	A:210-240
5c	PPTA-1ltxA04	A:210-240
5d	PPTA-1ltxA05	A:210-240
5e	PPTA-1ltxA06	A:210-240

Clan: no clan defined [family: RabGGT_insert] (1)

Family: RabGGT_insert (1)

Rattus norvegicus (Rat) (1)

RabGGT_insert-1ltxA07

A:244-346

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PGTA_RAT | Q08602)

molecular function
	GO:0017137	Rab GTPase binding	Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
	GO:0004663	Rab geranylgeranyltransferase activity	Catalysis of the reaction: 2 geranylgeranyl diphosphate + protein-cysteine = 2 S-geranylgeranyl-protein + 2 diphosphate. This reaction is the formation of two thioether linkages between the C-1 atom of the geranylgeranyl groups and two cysteine residues within the terminal sequence motifs XXCC, XCXC or CCXX. Known substrates include Ras-related GTPases of a single family and the Rab family.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0008318	protein prenyltransferase activity	Catalysis of the covalent addition of an isoprenoid group such as a farnesyl or geranylgeranyl group via thioether linkages to a cysteine residue in a protein.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0018344	protein geranylgeranylation	The covalent attachment of a geranylgeranyl group to a protein.
	GO:0018342	protein prenylation	The covalent attachment of a prenyl group to a protein; geranyl, farnesyl, or geranylgeranyl groups may be added.
cellular component
	GO:0005968	Rab-protein geranylgeranyltransferase complex	A heterodimeric enzyme complex, which in mammals is composed of an alpha and a beta subunit, and which associates with an accessory protein Rep (Rab escort protein). Catalyzes of the transfer of a geranyl-geranyl group from geranylgeranyl pyrophosphate to a Rab protein.

Chain B (PGTB2_RAT | Q08603)

molecular function
	GO:0017137	Rab GTPase binding	Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
	GO:0004663	Rab geranylgeranyltransferase activity	Catalysis of the reaction: 2 geranylgeranyl diphosphate + protein-cysteine = 2 S-geranylgeranyl-protein + 2 diphosphate. This reaction is the formation of two thioether linkages between the C-1 atom of the geranylgeranyl groups and two cysteine residues within the terminal sequence motifs XXCC, XCXC or CCXX. Known substrates include Ras-related GTPases of a single family and the Rab family.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0018344	protein geranylgeranylation	The covalent attachment of a geranylgeranyl group to a protein.
cellular component
	GO:0005968	Rab-protein geranylgeranyltransferase complex	A heterodimeric enzyme complex, which in mammals is composed of an alpha and a beta subunit, and which associates with an accessory protein Rep (Rab escort protein). Catalyzes of the transfer of a geranyl-geranyl group from geranylgeranyl pyrophosphate to a Rab protein.

Chain R (RAE1_RAT | P37727)

molecular function
	GO:0005092	GDP-dissociation inhibitor activity	Prevents the dissociation of GDP from a GTPase, thereby preventing GTP from binding.
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0017137	Rab GTPase binding	Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0018344	protein geranylgeranylation	The covalent attachment of a geranylgeranyl group to a protein.
	GO:0006612	protein targeting to membrane	The process of directing proteins towards a membrane, usually using signals contained within the protein.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
	GO:0005968	Rab-protein geranylgeranyltransferase complex	A heterodimeric enzyme complex, which in mammals is composed of an alpha and a beta subunit, and which associates with an accessory protein Rep (Rab escort protein). Catalyzes of the transfer of a geranyl-geranyl group from geranylgeranyl pyrophosphate to a Rab protein.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FAR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ltx)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ltx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PGTA_RAT \| Q08602
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PGTB2_RAT \| Q08603
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RAE1_RAT \| P37727
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PGTA_RAT \| Q08602
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PGTB2_RAT \| Q08603
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RAE1_RAT \| P37727
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1dce	1DCE CONTAINS RAB GERANYLGERANYLTRANSFERASE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (15, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (6, 6)

CATH Domains (7, 7)

Pfam Domains (6, 12)

Gene Ontology (23, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File