|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1LKN) |
Sites (0, 0)| (no "Site" information available for 1LKN) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1LKN) |
Cis Peptide Bonds (1, 1)
NMR Structure
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LKN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LKN) |
Exons (0, 0)| (no "Exon" information available for 1LKN) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:89 aligned with Q9X0J6_THEMA | Q9X0J6 from UniProtKB/TrEMBL Length:89 Alignment length:89 10 20 30 40 50 60 70 80 Q9X0J6_THEMA 1 MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 SCOP domains d1lkna_ A: Hypothetical protein TM1112 SCOP domains CATH domains 1lknA00 A:1-89 Jelly Rolls CATH domains Pfam domains ------------Cupin_3-1lknA01 A:13-86 --- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1lkn A 1 MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF 89 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1LKN)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|