1LI1 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THE 1.9-A CRYSTAL STRUCTURE OF THE NONCOLLAGENOUS (NC1) DOMAIN OF HUMAN PLACENTA COLLAGEN IV SHOWS STABILIZATION VIA A NOVEL TYPE OF COVALENT MET-LYS CROSS-LINK

Authors :   M. E. Than, S. Henrich, R. Huber, A. Ries, K. Mann, K. Kuhn, R. Timpl, G. P. Bourenkov, H. D. Bartunik, W. Bode

Date :   17 Apr 02 (Deposition) - 22 May 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Basement Membrane, Collagen Iv, Nc1 Domain, Covalent Cross- Link, Protein-Protein Interaction, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. E. Than, S. Henrich, R. Huber, A. Ries, K. Mann, K. Kuhn, R. Timpl, G. P. Bourenkov, H. D. Bartunik, W. Bode
The 1. 9-A Crystal Structure Of The Noncollagenous (Nc1) Domain Of Human Placenta Collagen Iv Shows Stabilization Via A Novel Type Of Covalent Met-Lys Cross-Link.
Proc. Natl. Acad. Sci. Usa V. 99 6607 2002
PubMed-ID: 12011424 | Reference-DOI: 10.1073/PNAS.062183499
(for further references see the PDB file header)

Molecule 1 - COLLAGEN ALPHA 1(IV)
	Chains	:	A, B, D, E
	Fragment	:	NONCOLLAGENOUS DOMAIN 1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	PLACENTA

Molecule 2 - COLLAGEN ALPHA 2(IV)
	Chains	:	C, F
	Fragment	:	NONCOLLAGENOUS DOMAIN 1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	PLACENTA

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 9)

No.	Name	Count	Type	Full Name
1	ACT	9	Ligand/Ion	ACETATE ION

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:185 , ALA A:186 , PHE D:64 , ASN D:66 , HOH D:2070 , TYR E:189	BINDING SITE FOR RESIDUE ACT E 2001
2	AC2	SOFTWARE	PHE A:64 , ASN A:66 , HOH A:2042 , TYR B:189 , TYR D:185 , ALA D:186	BINDING SITE FOR RESIDUE ACT B 2002
3	AC3	SOFTWARE	ALA B:186 , HOH B:2171 , TYR D:189 , TYR F:64 , TYR F:72	BINDING SITE FOR RESIDUE ACT B 2003
4	AC4	SOFTWARE	TYR A:189 , TYR C:64 , TYR C:72 , HOH C:2091 , TYR E:185 , ALA E:186	BINDING SITE FOR RESIDUE ACT C 2004
5	AC5	SOFTWARE	TYR C:185 , ALA C:186 , HOH C:2135 , PHE E:64 , ASN E:66 , TYR F:189	BINDING SITE FOR RESIDUE ACT C 2005
6	AC6	SOFTWARE	PHE B:64 , ASN B:66 , ASN B:72 , HOH B:2123 , TYR C:189 , TYR F:185 , ALA F:186	BINDING SITE FOR RESIDUE ACT B 2006
7	AC7	SOFTWARE	ALA B:212 , GLY B:213 , GLU B:214 , LEU B:215 , ARG B:216	BINDING SITE FOR RESIDUE ACT B 2007
8	AC8	SOFTWARE	HOH B:2175 , ARG D:102 , ARG E:198 , MET E:201 , PHE E:202 , HOH E:2041	BINDING SITE FOR RESIDUE ACT D 2008
9	AC9	SOFTWARE	ARG A:102 , HOH A:2171 , ARG B:198 , MET B:201 , PHE B:202 , HOH B:2059 , HOH B:2170 , HOH E:2170	BINDING SITE FOR RESIDUE ACT A 2009

Asymmetric/Biological Unit

No.	Residues
1	A:20	-	A:111
2	A:53	-	A:108
3	A:65	-	A:71
4	A:130	-	A:225
5	A:164	-	A:222
6	A:176	-	A:182
7	B:20	-	B:111
8	B:53	-	B:108
9	B:65	-	B:71
10	B:130	-	B:225
11	B:164	-	B:222
12	B:176	-	B:182
13	C:20	-	C:111
14	C:53	-	C:108
15	C:65	-	C:71
16	C:130	-	C:225
17	C:164	-	C:222
18	C:176	-	C:182
19	D:20	-	D:111
20	D:53	-	D:108
21	D:65	-	D:71
22	D:130	-	D:225
23	D:164	-	D:222
24	D:176	-	D:182
25	E:20	-	E:111
26	E:53	-	E:108
27	E:65	-	E:71
28	E:130	-	E:225
29	E:164	-	E:222
30	E:176	-	E:182
31	F:20	-	F:111
32	F:53	-	F:108
33	F:65	-	F:71
34	F:130	-	F:225
35	F:164	-	F:222
36	F:176	-	F:182

(no "Cis Peptide Bond" information available for 1LI1)

Asymmetric/Biological Unit (5, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_073824	M	1531	V	CO4A1_HUMAN	Polymorphism	---	A/B/D/E	M	91	V
2	UniProt	VAR_064499	G	1580	R	CO4A1_HUMAN	Disease (POREN1)	---	A/B/D/E	G	140	R
3	UniProt	VAR_073825	E	1615	K	CO4A1_HUMAN	Disease (SCHZC)	---	A/B/D/E	E	175	K
4	UniProt	VAR_073826	N	1627	K	CO4A1_HUMAN	Disease (BSVD)	---	A/B/D/E	N	187	K
5	UniProt	VAR_067558	A	1690	T	CO4A2_HUMAN	Polymorphism	201105747	C/F	A	207	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NC1_IV	PS51403	Collagen IV carboxyl-terminal non-collagenous (NC1) domain profile.	CO4A1_HUMAN	1445-1669	4	A:5-229 B:5-229 D:5-229 E:5-229
1	NC1_IV	PS51403		CO4A2_HUMAN	1489-1712	2	C:5-229 F:5-229

Asymmetric/Biological Unit (8, 26)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000360467	2a	ENSE00001888071	chr13:110959614-110959875	262	CO4A2_HUMAN	-	0	0	-	-
1.3	ENST00000360467	3	ENSE00002157738	chr13:110960207-110960294	88	CO4A2_HUMAN	1-15	15	0	-	-
1.4	ENST00000360467	4	ENSE00001345176	chr13:110960416-110960470	55	CO4A2_HUMAN	15-33	19	0	-	-
1.6	ENST00000360467	6	ENSE00001345173	chr13:111009819-111009899	81	CO4A2_HUMAN	34-60	27	0	-	-
1.7	ENST00000360467	7	ENSE00002184438	chr13:111077081-111077215	135	CO4A2_HUMAN	61-105	45	0	-	-
1.8	ENST00000360467	8	ENSE00001468459	chr13:111077300-111077344	45	CO4A2_HUMAN	106-120	15	0	-	-
1.9	ENST00000360467	9	ENSE00000917128	chr13:111080814-111080930	117	CO4A2_HUMAN	121-159	39	0	-	-
1.10	ENST00000360467	10	ENSE00001468458	chr13:111082232-111082303	72	CO4A2_HUMAN	160-183	24	0	-	-
1.11b	ENST00000360467	11b	ENSE00001468457	chr13:111082748-111082783	36	CO4A2_HUMAN	184-195	12	0	-	-
1.12a	ENST00000360467	12a	ENSE00001468456	chr13:111082892-111082954	63	CO4A2_HUMAN	196-216	21	0	-	-
1.13	ENST00000360467	13	ENSE00001468455	chr13:111084672-111084707	36	CO4A2_HUMAN	217-228	12	0	-	-
1.14	ENST00000360467	14	ENSE00001468454	chr13:111086748-111086789	42	CO4A2_HUMAN	229-242	14	0	-	-
1.15	ENST00000360467	15	ENSE00001468452	chr13:111088616-111088714	99	CO4A2_HUMAN	243-275	33	0	-	-
1.16	ENST00000360467	16	ENSE00001468451	chr13:111090349-111090384	36	CO4A2_HUMAN	276-287	12	0	-	-
1.17	ENST00000360467	17	ENSE00001468450	chr13:111090965-111091015	51	CO4A2_HUMAN	288-304	17	0	-	-
1.18	ENST00000360467	18	ENSE00001468449	chr13:111092136-111092180	45	CO4A2_HUMAN	305-319	15	0	-	-
1.19	ENST00000360467	19	ENSE00001468448	chr13:111098176-111098229	54	CO4A2_HUMAN	320-337	18	0	-	-
1.20	ENST00000360467	20	ENSE00001468447	chr13:111099145-111099211	67	CO4A2_HUMAN	338-360	23	0	-	-
1.21	ENST00000360467	21	ENSE00001411713	chr13:111102026-111102136	111	CO4A2_HUMAN	360-397	38	0	-	-
1.22	ENST00000360467	22	ENSE00000917138	chr13:111102652-111102801	150	CO4A2_HUMAN	397-447	51	0	-	-
1.23	ENST00000360467	23	ENSE00001468446	chr13:111109690-111109782	93	CO4A2_HUMAN	447-478	32	0	-	-
1.24	ENST00000360467	24	ENSE00000940293	chr13:111111118-111111281	164	CO4A2_HUMAN	478-532	55	0	-	-
1.25b	ENST00000360467	25b	ENSE00001468445	chr13:111114461-111114533	73	CO4A2_HUMAN	533-557	25	0	-	-
1.26a	ENST00000360467	26a	ENSE00000940295	chr13:111114625-111114731	107	CO4A2_HUMAN	557-592	36	0	-	-
1.27	ENST00000360467	27	ENSE00000854143	chr13:111117752-111117953	202	CO4A2_HUMAN	593-660	68	0	-	-
1.28	ENST00000360467	28	ENSE00001468444	chr13:111118350-111118409	60	CO4A2_HUMAN	660-680	21	0	-	-
1.29	ENST00000360467	29	ENSE00001468443	chr13:111119387-111119443	57	CO4A2_HUMAN	680-699	20	0	-	-
1.30	ENST00000360467	30	ENSE00000917140	chr13:111121564-111121671	108	CO4A2_HUMAN	699-735	37	0	-	-
1.31a	ENST00000360467	31a	ENSE00000940296	chr13:111125276-111125497	222	CO4A2_HUMAN	735-809	75	0	-	-
1.33b	ENST00000360467	33b	ENSE00000917144	chr13:111130350-111130511	162	CO4A2_HUMAN	809-863	55	0	-	-
1.34	ENST00000360467	34	ENSE00000917145	chr13:111132567-111132737	171	CO4A2_HUMAN	863-920	58	0	-	-
1.35b	ENST00000360467	35b	ENSE00000940297	chr13:111134863-111135006	144	CO4A2_HUMAN	920-968	49	0	-	-
1.36a	ENST00000360467	36a	ENSE00001468428	chr13:111137252-111137374	123	CO4A2_HUMAN	968-1009	42	0	-	-
1.37b	ENST00000360467	37b	ENSE00000917147	chr13:111138002-111138183	182	CO4A2_HUMAN	1009-1069	61	0	-	-
1.38	ENST00000360467	38	ENSE00001468438	chr13:111141792-111141855	64	CO4A2_HUMAN	1070-1091	22	0	-	-
1.39	ENST00000360467	39	ENSE00000940300	chr13:111142058-111142132	75	CO4A2_HUMAN	1091-1116	26	0	-	-
1.40	ENST00000360467	40	ENSE00001468437	chr13:111143580-111143687	108	CO4A2_HUMAN	1116-1152	37	0	-	-
1.41	ENST00000360467	41	ENSE00001300860	chr13:111144417-111144524	108	CO4A2_HUMAN	1152-1188	37	0	-	-
1.42	ENST00000360467	42	ENSE00001468435	chr13:111145558-111145629	72	CO4A2_HUMAN	1188-1212	25	0	-	-
1.43	ENST00000360467	43	ENSE00000940304	chr13:111147689-111147814	126	CO4A2_HUMAN	1212-1254	43	0	-	-
1.44	ENST00000360467	44	ENSE00001468434	chr13:111154015-111154131	117	CO4A2_HUMAN	1254-1293	40	0	-	-
1.45	ENST00000360467	45	ENSE00000940306	chr13:111155468-111155629	162	CO4A2_HUMAN	1293-1347	55	0	-	-
1.46	ENST00000360467	46	ENSE00000940307	chr13:111155730-111155828	99	CO4A2_HUMAN	1347-1380	34	0	-	-
1.47	ENST00000360467	47	ENSE00001468433	chr13:111156194-111156340	147	CO4A2_HUMAN	1380-1429	50	0	-	-
1.48	ENST00000360467	48	ENSE00001321025	chr13:111156495-111156611	117	CO4A2_HUMAN	1429-1468	40	0	-	-
1.49a	ENST00000360467	49a	ENSE00000940310	chr13:111158762-111158953	192	CO4A2_HUMAN	1468-1532	65	2	C:5-48 F:4-48	44 45
1.51a	ENST00000360467	51a	ENSE00000940311	chr13:111160282-111160568	287	CO4A2_HUMAN	1532-1627	96	2	C:48-145 (gaps) F:48-145 (gaps)	98 98
1.52b	ENST00000360467	52b	ENSE00001378931	chr13:111164281-111165374	1094	CO4A2_HUMAN	1628-1712	85	2	C:146-229 F:146-229	85 85

2.1	ENST00000375820	1	ENSE00001468541	chr13:110959496-110959291	206	CO4A1_HUMAN	1-28	28	0	-	-
2.2	ENST00000375820	2	ENSE00001388790	chr13:110895081-110895022	60	CO4A1_HUMAN	29-48	20	0	-	-
2.3	ENST00000375820	3	ENSE00001371543	chr13:110866362-110866273	90	CO4A1_HUMAN	49-78	30	0	-	-
2.4	ENST00000375820	4	ENSE00001381957	chr13:110866173-110866129	45	CO4A1_HUMAN	79-93	15	0	-	-
2.5	ENST00000375820	5	ENSE00001369972	chr13:110864965-110864921	45	CO4A1_HUMAN	94-108	15	0	-	-
2.6	ENST00000375820	6	ENSE00001379642	chr13:110864826-110864764	63	CO4A1_HUMAN	109-129	21	0	-	-
2.7	ENST00000375820	7	ENSE00001371609	chr13:110864269-110864216	54	CO4A1_HUMAN	130-147	18	0	-	-
2.8	ENST00000375820	8	ENSE00001368589	chr13:110864020-110863994	27	CO4A1_HUMAN	148-156	9	0	-	-
2.9	ENST00000375820	9	ENSE00001378972	chr13:110862559-110862476	84	CO4A1_HUMAN	157-184	28	0	-	-
2.10	ENST00000375820	10	ENSE00001372483	chr13:110862389-110862327	63	CO4A1_HUMAN	185-205	21	0	-	-
2.11	ENST00000375820	11	ENSE00001374078	chr13:110861774-110861739	36	CO4A1_HUMAN	206-217	12	0	-	-
2.12	ENST00000375820	12	ENSE00001385330	chr13:110861237-110861196	42	CO4A1_HUMAN	218-231	14	0	-	-
2.13	ENST00000375820	13	ENSE00001387152	chr13:110859836-110859750	87	CO4A1_HUMAN	232-260	29	0	-	-
2.14	ENST00000375820	14	ENSE00001367184	chr13:110859238-110859212	27	CO4A1_HUMAN	261-269	9	0	-	-
2.15	ENST00000375820	15	ENSE00001384077	chr13:110859062-110859012	51	CO4A1_HUMAN	270-286	17	0	-	-
2.16	ENST00000375820	16	ENSE00001380858	chr13:110857885-110857841	45	CO4A1_HUMAN	287-301	15	0	-	-
2.17	ENST00000375820	17	ENSE00001365411	chr13:110857753-110857700	54	CO4A1_HUMAN	302-319	18	0	-	-
2.18	ENST00000375820	18	ENSE00001382766	chr13:110855954-110855913	42	CO4A1_HUMAN	320-333	14	0	-	-
2.19	ENST00000375820	19	ENSE00001375883	chr13:110853869-110853785	85	CO4A1_HUMAN	334-362	29	0	-	-
2.20	ENST00000375820	20	ENSE00001366314	chr13:110853236-110853201	36	CO4A1_HUMAN	362-374	13	0	-	-
2.21	ENST00000375820	21	ENSE00001384920	chr13:110850978-110850814	165	CO4A1_HUMAN	374-429	56	0	-	-
2.22	ENST00000375820	22	ENSE00001368867	chr13:110847465-110847370	96	CO4A1_HUMAN	429-461	33	0	-	-
2.23	ENST00000375820	23	ENSE00001377683	chr13:110845260-110845177	84	CO4A1_HUMAN	461-489	29	0	-	-
2.24c	ENST00000375820	24c	ENSE00001383389	chr13:110844631-110844561	71	CO4A1_HUMAN	489-512	24	0	-	-
2.25	ENST00000375820	25	ENSE00001351451	chr13:110839676-110839485	192	CO4A1_HUMAN	513-576	64	0	-	-
2.26	ENST00000375820	26	ENSE00001368411	chr13:110838900-110838732	169	CO4A1_HUMAN	577-633	57	0	-	-
2.27	ENST00000375820	27	ENSE00001372167	chr13:110835623-110835531	93	CO4A1_HUMAN	633-664	32	0	-	-
2.28	ENST00000375820	28	ENSE00001383619	chr13:110835444-110835340	105	CO4A1_HUMAN	664-699	36	0	-	-
2.29	ENST00000375820	29	ENSE00001377678	chr13:110833736-110833639	98	CO4A1_HUMAN	699-731	33	0	-	-
2.30	ENST00000375820	30	ENSE00001367837	chr13:110831768-110831618	151	CO4A1_HUMAN	732-782	51	0	-	-
2.31	ENST00000375820	31	ENSE00001369622	chr13:110831383-110831270	114	CO4A1_HUMAN	782-820	39	0	-	-
2.32a	ENST00000375820	32a	ENSE00001380612	chr13:110830578-110830411	168	CO4A1_HUMAN	820-876	57	0	-	-
2.33	ENST00000375820	33	ENSE00001386943	chr13:110830278-110830189	90	CO4A1_HUMAN	876-906	31	0	-	-
2.34	ENST00000375820	34	ENSE00001390718	chr13:110829384-110829232	153	CO4A1_HUMAN	906-957	52	0	-	-
2.35	ENST00000375820	35	ENSE00001366386	chr13:110829071-110828973	99	CO4A1_HUMAN	957-990	34	0	-	-
2.36	ENST00000375820	36	ENSE00001375462	chr13:110828860-110828771	90	CO4A1_HUMAN	990-1020	31	0	-	-
2.37	ENST00000375820	37	ENSE00001386278	chr13:110827704-110827565	140	CO4A1_HUMAN	1020-1066	47	0	-	-
2.38	ENST00000375820	38	ENSE00001388916	chr13:110827096-110826970	127	CO4A1_HUMAN	1067-1109	43	0	-	-
2.39	ENST00000375820	39	ENSE00001373789	chr13:110826873-110826793	81	CO4A1_HUMAN	1109-1136	28	0	-	-
2.40	ENST00000375820	40	ENSE00001387730	chr13:110826345-110826247	99	CO4A1_HUMAN	1136-1169	34	0	-	-
2.41	ENST00000375820	41	ENSE00001381072	chr13:110825117-110825067	51	CO4A1_HUMAN	1169-1186	18	0	-	-
2.42	ENST00000375820	42	ENSE00001366193	chr13:110823079-110822894	186	CO4A1_HUMAN	1186-1248	63	0	-	-
2.43	ENST00000375820	43	ENSE00001374535	chr13:110822109-110821976	134	CO4A1_HUMAN	1248-1292	45	0	-	-
2.44	ENST00000375820	44	ENSE00001379606	chr13:110819577-110819505	73	CO4A1_HUMAN	1293-1317	25	0	-	-
2.45	ENST00000375820	45	ENSE00001366657	chr13:110818650-110818579	72	CO4A1_HUMAN	1317-1341	25	0	-	-
2.46	ENST00000375820	46	ENSE00001367416	chr13:110817337-110817209	129	CO4A1_HUMAN	1341-1384	44	0	-	-
2.47a	ENST00000375820	47a	ENSE00001380684	chr13:110815908-110815810	99	CO4A1_HUMAN	1384-1417	34	0	-	-
2.48a	ENST00000375820	48a	ENSE00001384242	chr13:110814789-110814577	213	CO4A1_HUMAN	1417-1488	72	4	A:2-48 B:3-48 D:2-48 E:3-48	47 46 47 46
2.49a	ENST00000375820	49a	ENSE00001391003	chr13:110813716-110813539	178	CO4A1_HUMAN	1488-1547	60	4	A:48-107 B:48-107 D:48-107 E:48-107	60 60 60 60
2.50	ENST00000375820	50	ENSE00001365839	chr13:110807744-110807630	115	CO4A1_HUMAN	1547-1585	39	4	A:107-145 B:107-145 D:107-145 E:107-145	39 39 39 39
2.51	ENST00000375820	51	ENSE00001373536	chr13:110804853-110804681	173	CO4A1_HUMAN	1586-1643	58	4	A:146-203 B:146-203 D:146-203 E:146-203	58 58 58 58
2.52b	ENST00000375820	52b	ENSE00001468488	chr13:110802791-110801318	1474	CO4A1_HUMAN	1643-1669	27	4	A:203-229 B:203-229 D:203-229 E:203-229	27 27 27 27

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:228
 aligned with CO4A1_HUMAN | P02462 from UniProtKB/Swiss-Prot  Length:1669

    Alignment length:228
                                  1451      1461      1471      1481      1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661        
         CO4A1_HUMAN   1442 VDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1669
               SCOP domains d1li1a1 A:2-114 Noncollagenous (NC1) domain of collagen IV                                                       d1li1a2 A:115-229 Noncollagenous (NC1) domain of collagen IV                                                        SCOP domains
               CATH domains 1li1A00 A:2-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee...........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------V------------------------------------------------R----------------------------------K-----------K------------------------------------------ SAPs(SNPs)
                    PROSITE ---NC1_IV  PDB: A:5-229 UniProt: 1445-1669                                                                                                                                                                                           PROSITE
           Transcript 2 (1) Exon 2.48a  PDB: A:2-48 UniProt: 1417-1488     ----------------------------------------------------------Exon 2.50  PDB: A:107-145              Exon 2.51  PDB: A:146-203 UniProt: 1586-1643              -------------------------- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.49a  PDB: A:48-107 UniProt: 1488-1547                -----------------------------------------------------------------------------------------------Exon 2.52b  PDB: A:203-229  Transcript 2 (2)
                1li1 A    2 VDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT  229
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain B from PDB  Type:PROTEIN  Length:227
 aligned with CO4A1_HUMAN | P02462 from UniProtKB/Swiss-Prot  Length:1669

    Alignment length:227
                                  1452      1462      1472      1482      1492      1502      1512      1522      1532      1542      1552      1562      1572      1582      1592      1602      1612      1622      1632      1642      1652      1662       
         CO4A1_HUMAN   1443 DHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1669
               SCOP domains d1li1b1 B:3-114 Noncollagenous (NC1) domain of collagen IV                                                      d1li1b2 B:115-229 Noncollagenous (NC1) domain of collagen IV                                                        SCOP domains
               CATH domains 1li1B00 B:3-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee...........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------V------------------------------------------------R----------------------------------K-----------K------------------------------------------ SAPs(SNPs)
                    PROSITE --NC1_IV  PDB: B:5-229 UniProt: 1445-1669                                                                                                                                                                                           PROSITE
           Transcript 2 (1) Exon 2.48a  PDB: B:3-48 UniProt: 1417-1488    ----------------------------------------------------------Exon 2.50  PDB: B:107-145              Exon 2.51  PDB: B:146-203 UniProt: 1586-1643              -------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------Exon 2.49a  PDB: B:48-107 UniProt: 1488-1547                -----------------------------------------------------------------------------------------------Exon 2.52b  PDB: B:203-229  Transcript 2 (2)
                1li1 B    3 DHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT  229
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222

Chain C from PDB  Type:PROTEIN  Length:224
 aligned with CO4A2_HUMAN | P08572 from UniProtKB/Swiss-Prot  Length:1712

    Alignment length:224
                                  1498      1508      1518      1528      1538      1548      1558      1568      1578      1588      1598      1608      1618      1628      1638      1648      1658      1668      1678      1688      1698      1708    
         CO4A2_HUMAN   1489 GYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLIRTHISRCQVCMKNL 1712
               SCOP domains d1li1c1 C:5-114 Noncollagenous (NC1) domain of collagen IV                                                  d1li1c2 C:115-229 Noncollagenous (NC1) domain of collagen IV                                                         SCOP domains
               CATH domains 1li1C00 C:5-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee.........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------------- SAPs(SNPs)
                PROSITE (2) NC1_IV  PDB: C:5-229 UniProt: 1489-1712                                                                                                                                                                                          PROSITE (2)
           Transcript 1 (1) Exon 1.49a  PDB: C:5-48 UniProt: 1468-1532  -----------------------------------------------------------------------------------------------Exon 1.52b  PDB: C:146-229 UniProt: 1628-1712                                         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.51a  PDB: C:48-145 (gaps) UniProt: 1532-1627                                             ------------------------------------------------------------------------------------- Transcript 1 (2)
                1li1 C    5 GYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLIRTHISRCQVCMKNL  229
                                    14        24        34        44        54        64        74        84     || 96       106       116       126       136       146       156       166       176 |     185       195       205       215       225    
                                                                                                                90|                                                                                 177A                                                    
                                                                                                                 93

Chain D from PDB  Type:PROTEIN  Length:228
 aligned with CO4A1_HUMAN | P02462 from UniProtKB/Swiss-Prot  Length:1669

    Alignment length:228
                                  1451      1461      1471      1481      1491      1501      1511      1521      1531      1541      1551      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661        
         CO4A1_HUMAN   1442 VDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1669
               SCOP domains d1li1d1 D:2-114 Noncollagenous (NC1) domain of collagen IV                                                       d1li1d2 D:115-229 Noncollagenous (NC1) domain of collagen IV                                                        SCOP domains
               CATH domains 1li1D00 D:2-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee...........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------V------------------------------------------------R----------------------------------K-----------K------------------------------------------ SAPs(SNPs)
                    PROSITE ---NC1_IV  PDB: D:5-229 UniProt: 1445-1669                                                                                                                                                                                           PROSITE
           Transcript 2 (1) Exon 2.48a  PDB: D:2-48 UniProt: 1417-1488     ----------------------------------------------------------Exon 2.50  PDB: D:107-145              Exon 2.51  PDB: D:146-203 UniProt: 1586-1643              -------------------------- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.49a  PDB: D:48-107 UniProt: 1488-1547                -----------------------------------------------------------------------------------------------Exon 2.52b  PDB: D:203-229  Transcript 2 (2)
                1li1 D    2 VDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT  229
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain E from PDB  Type:PROTEIN  Length:227
 aligned with CO4A1_HUMAN | P02462 from UniProtKB/Swiss-Prot  Length:1669

    Alignment length:227
                                  1452      1462      1472      1482      1492      1502      1512      1522      1532      1542      1552      1562      1572      1582      1592      1602      1612      1622      1632      1642      1652      1662       
         CO4A1_HUMAN   1443 DHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1669
               SCOP domains d1li1e1 E:3-114 Noncollagenous (NC1) domain of collagen IV                                                      d1li1e2 E:115-229 Noncollagenous (NC1) domain of collagen IV                                                        SCOP domains
               CATH domains 1li1E00 E:3-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                          CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------------------------------------------C4-1li1E01 E:115-228                                                                                              - Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------------------------------C4-1li1E02 E:115-228                                                                                              - Pfam domains (2)
           Pfam domains (3) ----------------------------------------------------------------------------------------------------------------C4-1li1E03 E:115-228                                                                                              - Pfam domains (3)
           Pfam domains (4) ----------------------------------------------------------------------------------------------------------------C4-1li1E04 E:115-228                                                                                              - Pfam domains (4)
           Pfam domains (5) ----------------------------------------------------------------------------------------------------------------C4-1li1E05 E:115-228                                                                                              - Pfam domains (5)
           Pfam domains (6) ----------------------------------------------------------------------------------------------------------------C4-1li1E06 E:115-228                                                                                              - Pfam domains (6)
           Pfam domains (7) ----------------------------------------------------------------------------------------------------------------C4-1li1E07 E:115-228                                                                                              - Pfam domains (7)
           Pfam domains (8) ----------------------------------------------------------------------------------------------------------------C4-1li1E08 E:115-228                                                                                              - Pfam domains (8)
         Sec.struct. author ...eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee...........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------V------------------------------------------------R----------------------------------K-----------K------------------------------------------ SAPs(SNPs)
                    PROSITE --NC1_IV  PDB: E:5-229 UniProt: 1445-1669                                                                                                                                                                                           PROSITE
           Transcript 2 (1) Exon 2.48a  PDB: E:3-48 UniProt: 1417-1488    ----------------------------------------------------------Exon 2.50  PDB: E:107-145              Exon 2.51  PDB: E:146-203 UniProt: 1586-1643              -------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------Exon 2.49a  PDB: E:48-107 UniProt: 1488-1547                -----------------------------------------------------------------------------------------------Exon 2.52b  PDB: E:203-229  Transcript 2 (2)
                1li1 E    3 DHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT  229
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222

Chain F from PDB  Type:PROTEIN  Length:225
 aligned with CO4A2_HUMAN | P08572 from UniProtKB/Swiss-Prot  Length:1712

    Alignment length:225
                                  1497      1507      1517      1527      1537      1547      1557      1567      1577      1587      1597      1607      1617      1627      1637      1647      1657      1667      1677      1687      1697      1707     
         CO4A2_HUMAN   1488 IGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLIRTHISRCQVCMKNL 1712
               SCOP domains d1li1f1 F:4-114 Noncollagenous (NC1) domain of collagen IV                                                   d1li1f2 F:115-229 Noncollagenous (NC1) domain of collagen IV                                                         SCOP domains
               CATH domains 1li1F00 F:4-229 Noncollagenous (NC1) domain of collagen IV                                                                                                                                                                        CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------C4-1li1F01 F:115-228                                                                                               - Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------C4-1li1F02 F:115-228                                                                                               - Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------C4-1li1F03 F:115-228                                                                                               - Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------C4-1li1F04 F:115-228                                                                                               - Pfam domains (4)
         Sec.struct. author ..eeeeeee............eeeeeeeeeeeeee..eeeee...............eeeeee..eeeee.....eeeeee.........eeehhhhhh.eeeeeeee..eeeeeee..........eeeeeeeeeeeeeeee...eeeee...............eeeeeeee.eeee.....eeeeee.............eee....hhhhheeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------------- SAPs(SNPs)
                PROSITE (2) -NC1_IV  PDB: F:5-229 UniProt: 1489-1712                                                                                                                                                                                          PROSITE (2)
           Transcript 1 (1) Exon 1.49a  PDB: F:4-48 UniProt: 1468-1532   -----------------------------------------------------------------------------------------------Exon 1.52b  PDB: F:146-229 UniProt: 1628-1712                                         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.51a  PDB: F:48-145 (gaps) UniProt: 1532-1627                                             ------------------------------------------------------------------------------------- Transcript 1 (2)
                1li1 F    4 IGYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLIRTHISRCQVCMKNL  229
                                    13        23        33        43        53        63        73        83      ||95       105       115       125       135       145       155       165       175  |    184       194       204       214       224     
                                                                                                                 90|                                                                                 177A                                                    
                                                                                                                  93

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: C-type lectin-like (322)

Superfamily: C-type lectin-like (322)

Family: Noncollagenous (NC1) domain of collagen IV (4)

Protein domain: Noncollagenous (NC1) domain of collagen IV (4)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d1li1a1	A:2-114
1b	d1li1a2	A:115-229
1c	d1li1f1	F:4-114
1d	d1li1f2	F:115-229
1e	d1li1b1	B:3-114
1f	d1li1b2	B:115-229
1g	d1li1c1	C:5-114
1h	d1li1c2	C:115-229
1i	d1li1d1	D:2-114
1j	d1li1d2	D:115-229
1k	d1li1e1	E:3-114
1l	d1li1e2	E:115-229

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Complex (381)

Topology: Noncollagenous (NC1) domain of collagen IV (4)

Homologous Superfamily: Noncollagenous (NC1) domain of collagen IV (4)

Human (Homo sapiens) (1)

1a	1li1B00	B:3-229
1b	1li1E00	E:3-229
1c	1li1A00	A:2-229
1d	1li1D00	D:2-229
1e	1li1C00	C:5-229
1f	1li1F00	F:4-229

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: C_Lectin (98)

Family: C4 (3)

Homo sapiens (Human) (1)

1a	C4-1li1E01	E:115-228
1b	C4-1li1E02	E:115-228
1c	C4-1li1E03	E:115-228
1d	C4-1li1E04	E:115-228
1e	C4-1li1E05	E:115-228
1f	C4-1li1E06	E:115-228
1g	C4-1li1E07	E:115-228
1h	C4-1li1E08	E:115-228
1i	C4-1li1F01	F:115-228
1j	C4-1li1F02	F:115-228
1k	C4-1li1F03	F:115-228
1l	C4-1li1F04	F:115-228

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,D,E (CO4A1_HUMAN | P02462)

molecular function
	GO:0030023	extracellular matrix constituent conferring elasticity	A component of the extracellular matrix that enables the matrix to recoil after transient stretching.
	GO:0005201	extracellular matrix structural constituent	The action of a molecule that contributes to the structural integrity of the extracellular matrix.
	GO:0048407	platelet-derived growth factor binding	Interacting selectively and non-covalently with platelet-derived growth factor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0071711	basement membrane organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the basement membrane.
	GO:0048514	blood vessel morphogenesis	The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:0001569	branching involved in blood vessel morphogenesis	The process of coordinated growth and sprouting of blood vessels giving rise to the organized vascular system.
	GO:0071230	cellular response to amino acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0030574	collagen catabolic process	The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0007528	neuromuscular junction development	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
	GO:0061333	renal tubule morphogenesis	The process in which the renal tubule is generated by specification of cell fate, through the maintenance of cell polarity, regulated cell proliferation and morphogenetic cell rearrangements, shape changes and growth. A renal tubule is a tube that filters, re-absorbs and secretes substances to rid an organism of waste and to play a role in fluid homeostasis.
	GO:0061304	retinal blood vessel morphogenesis	The process whose specific outcome is the progression of a blood vessel of the retina over time, from its formation to the mature structure.
cellular component
	GO:0005604	basement membrane	A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0005587	collagen type IV trimer	A collagen heterotrimer containing type IV alpha chains; [alpha1(IV)]2alpha2(IV) trimers are commonly observed, although more type IV alpha chains exist and may be present in type IV trimers; type IV collagen triple helices associate to form 3 dimensional nets within basement membranes.
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Chain C,F (CO4A2_HUMAN | P08572)

molecular function
	GO:0005201	extracellular matrix structural constituent	The action of a molecule that contributes to the structural integrity of the extracellular matrix.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0071560	cellular response to transforming growth factor beta stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
	GO:0030574	collagen catabolic process	The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
	GO:0035987	endodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an endoderm cell, a cell of the inner of the three germ layers of the embryo.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0016525	negative regulation of angiogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005604	basement membrane	A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0005587	collagen type IV trimer	A collagen heterotrimer containing type IV alpha chains; [alpha1(IV)]2alpha2(IV) trimers are commonly observed, although more type IV alpha chains exist and may be present in type IV trimers; type IV collagen triple helices associate to form 3 dimensional nets within basement membranes.
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1li1)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1li1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CO4A1_HUMAN \| P02462
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CO4A2_HUMAN \| P08572
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	175780
		Disease Information	:	OMIM
	269160
		Disease Information	:	OMIM
	607595
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CO4A1_HUMAN \| P02462
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CO4A2_HUMAN \| P08572
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1LI1)

(no "Related Entries Specified in the PDB File" available for 1LI1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 9)

Sites (9, 9)

SS Bonds (36, 36)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 18)

PROSITE Motifs (1, 6)

Exons (8, 26)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 12)

CATH Domains (1, 6)

Pfam Domains (1, 12)

Gene Ontology (29, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File