|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (2, 8) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1JOT) |
Asymmetric Unit
|
Asymmetric Unit (7, 7)
|
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 1JOT) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:133 aligned with LECA_MACPO | P18674 from UniProtKB/Swiss-Prot Length:133 Alignment length:133 10 20 30 40 50 60 70 80 90 100 110 120 130 LECA_MACPO 1 GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL 133 SCOP domains d1jot.2 B:,A: Lectin MPA SCOP domains CATH domains 1jotA00 A:1-133 [code=2.100.10.30, no name defined] CATH domains Pfam domains Jacalin-1jotA01 A:1-133 Pfam domains SAPs(SNPs) ------------------------------V--------------------T------D------------I--------V----------------------------Q-G--------------------- SAPs(SNPs) PROSITE JACALIN_LECTIN PDB: A:1-133 UniProt: 1-133 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript 1jot A 1 GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL 133 10 20 30 40 50 60 70 80 90 100 110 120 130 Chain B from PDB Type:PROTEIN Length:16 aligned with LECB2_MACPO | P18676 from UniProtKB/Swiss-Prot Length:20 Alignment length:16 11 LECB2_MACPO 2 RNGKSQSIIVGPWGDR 17 SCOP domains d1jot.2 B:,A: SCOP domains CATH domains ---------------- CATH domains Pfam domains ---------------- Pfam domains SAPs(SNPs) ---------------- SAPs(SNPs) PROSITE ---------------- PROSITE Transcript ---------------- Transcript 1jot B 3 RNGKSQSIIVGPWGDR 18 12
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (LECA_MACPO | P18674)
Chain B (LECB2_MACPO | P18676)
|
|
|
|
|
|
|