![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (2, 8) Biological Unit 2 (2, 2) Biological Unit 3 (2, 2) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3LLZ) |
Asymmetric Unit
|
Asymmetric Unit (7, 7)
|
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 3LLZ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:133 aligned with LECA_MACPO | P18674 from UniProtKB/Swiss-Prot Length:133 Alignment length:133 10 20 30 40 50 60 70 80 90 100 110 120 130 LECA_MACPO 1 GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL 133 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains Jacalin-3llzA01 A:1-133 Pfam domains SAPs(SNPs) ------------------------------V--------------------T------D------------I--------V----------------------------Q-G--------------------- SAPs(SNPs) PROSITE JACALIN_LECTIN PDB: A:1-133 UniProt: 1-133 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript 3llz A 1 GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL 133 10 20 30 40 50 60 70 80 90 100 110 120 130 Chain B from PDB Type:PROTEIN Length:14 aligned with LECB2_MACPO | P18676 from UniProtKB/Swiss-Prot Length:20 Alignment length:14 12 LECB2_MACPO 3 NGKSQSIIVGPWGD 16 SCOP domains -------------- SCOP domains CATH domains -------------- CATH domains Pfam domains -------------- Pfam domains SAPs(SNPs) -------------- SAPs(SNPs) PROSITE -------------- PROSITE Transcript -------------- Transcript 3llz B 3 NGKSQSIIVGPWGD 16 12
|
(no "SCOP Domain" information available for 3LLZ) |
(no "CATH Domain" information available for 3LLZ) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (LECA_MACPO | P18674)
Chain B (LECB2_MACPO | P18676)
|
|
|
|
|
|
|