1JNZ - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF ADENYLYLSULFATE REDUCTASE FROM THE HYPERTHERMOPHILIC ARCHAEOGLOBUS FULGIDUS AT 1.6 RESOLUTION

Authors :   G. Fritz, A. Roth, A. Schiffer, T. Buechert, G. Bourenkov, H. D. Bartunik, H. Huber, K. O. Stetter, P. M. Kroneck, U. Ermler

Date :   26 Jul 01 (Deposition) - 27 Mar 02 (Release) - 31 Mar 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Sulfur Metabolism, Adenylylsulfate Reductase, Iron-Sulfur Flavoprotein, Crystal Structure, Catalysis, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Fritz, A. Roth, A. Schiffer, T. Buchert, G. Bourenkov, H. D. Bartunik, H. Huber, K. O. Stetter, P. M. Kroneck, U. Ermler
Structure Of Adenylylsulfate Reductase From The Hyperthermophilic Archaeoglobus Fulgidus At 1. 6-A Resolution
Proc. Natl. Acad. Sci. Usa V. 99 1836 2002
PubMed-ID: 11842205 | Reference-DOI: 10.1073/PNAS.042664399
(for further references see the PDB file header)

Molecule 1 - ADENYLYLSULFATE REDUCTASE
	Chains	:	A, C
	EC Number	:	1.8.99.2
	Fragment	:	A SUBUNIT
	Organism Scientific	:	ARCHAEOGLOBUS FULGIDUS DSM 4304
	Organism Taxid	:	224325
	Strain	:	DSM4304

Molecule 2 - ADENYLYLSULFATE REDUCTASE
	Chains	:	B, D
	EC Number	:	1.8.99.2
	Fragment	:	B SUBUNIT
	Organism Scientific	:	ARCHAEOGLOBUS FULGIDUS DSM 4304
	Organism Taxid	:	224325
	Strain	:	DSM4304

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 8)

No.	Name	Count	Type	Full Name
1	FAD	2	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
2	SF4	4	Ligand/Ion	IRON/SULFUR CLUSTER
3	SO3	2	Ligand/Ion	SULFITE ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN A:74 , TRP A:234 , ARG A:265 , MET A:365 , HIS A:398 , FAD A:1000 , HOH A:5041 , HOH A:7001	BINDING SITE FOR RESIDUE SO3 A 1001
2	AC2	SOFTWARE	ASN C:2074 , ARG C:2265 , MET C:2365 , HIS C:2398 , FAD C:3000 , HOH C:5001	BINDING SITE FOR RESIDUE SO3 C 3001
3	AC3	SOFTWARE	GLY A:29 , GLY A:31 , PHE A:32 , SER A:33 , GLU A:56 , LYS A:57 , SER A:63 , GLY A:64 , ALA A:65 , VAL A:66 , LEU A:70 , ALA A:72 , ILE A:73 , ASN A:74 , VAL A:174 , PHE A:175 , ILE A:176 , ALA A:213 , THR A:214 , GLY A:215 , TRP A:234 , TYR A:235 , ALA A:236 , ASP A:239 , SER A:242 , MET A:365 , SER A:397 , GLY A:438 , ASP A:439 , PHE A:448 , SER A:449 , SER A:452 , SO3 A:1001 , HOH A:5121 , HOH A:5316 , HOH A:5321 , HOH A:5718 , HOH A:7001 , TRP B:748 , HOH B:5045	BINDING SITE FOR RESIDUE FAD A 1000
4	AC4	SOFTWARE	GLY C:2029 , GLY C:2030 , GLY C:2031 , PHE C:2032 , SER C:2033 , GLU C:2056 , LYS C:2057 , SER C:2063 , GLY C:2064 , ALA C:2065 , VAL C:2066 , LEU C:2070 , ALA C:2072 , ILE C:2073 , ASN C:2074 , VAL C:2174 , PHE C:2175 , ILE C:2176 , ALA C:2213 , THR C:2214 , GLY C:2215 , TRP C:2234 , TYR C:2235 , ALA C:2236 , ASP C:2239 , SER C:2242 , MET C:2365 , THR C:2366 , SER C:2397 , GLY C:2438 , ASP C:2439 , PHE C:2448 , SER C:2449 , SER C:2452 , SO3 C:3001 , HOH C:5008 , HOH C:5048 , HOH C:5059 , HOH C:5197 , HOH C:5320 , HOH C:5621 , TRP D:2748	BINDING SITE FOR RESIDUE FAD C 3000
5	AC5	SOFTWARE	SER B:703 , CYS B:725 , ASN B:741 , CYS B:747 , TRP B:748 , GLU B:749 , CYS B:750 , TYR B:751 , SER B:752 , CYS B:753	BINDING SITE FOR RESIDUE SF4 B 1100
6	AC6	SOFTWARE	CYS B:710 , ASP B:711 , GLY B:712 , CYS B:713 , THR B:719 , ALA B:720 , CYS B:721 , CYS B:757 , ILE B:762	BINDING SITE FOR RESIDUE SF4 B 1110
7	AC7	SOFTWARE	SER D:2703 , CYS D:2725 , PRO D:2726 , CYS D:2747 , TRP D:2748 , CYS D:2750 , TYR D:2751 , CYS D:2753	BINDING SITE FOR RESIDUE SF4 D 3100
8	AC8	SOFTWARE	CYS D:2710 , ASP D:2711 , GLY D:2712 , CYS D:2713 , THR D:2719 , ALA D:2720 , CYS D:2721 , CYS D:2757 , GLN D:2759 , ILE D:2762	BINDING SITE FOR RESIDUE SF4 D 3110

(no "SS Bond" information available for 1JNZ)

Asymmetric/Biological Unit

No.	Residues
1	Lys A:304	-	Pro A:305
2	Gln A:310	-	Pro A:311
3	Gln A:330	-	Pro A:331
4	Glu B:834	-	Pro B:835
5	Lys C:2304	-	Pro C:2305
6	Gln C:2310	-	Pro C:2311
7	Gln C:2330	-	Pro C:2331
8	Glu D:2834	-	Pro D:2835

(no "SAP(SNP)/Variant" information available for 1JNZ)

(no "PROSITE Motif" information available for 1JNZ)

(no "Exon" information available for 1JNZ)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:642
 aligned with O28603_ARCFU | O28603 from UniProtKB/TrEMBL  Length:643

    Alignment length:642
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641  
        O28603_ARCFU      2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
               SCOP domains d1jnza2 A:2-256,A:402-502 Adenylylsulfate reductase A subunit                                                                                                                                                                                                  d1jnza3 A:257-401 Adenylylsulfate reductase A subunit                                                                                            d1jnza2 A:2-256,A:402-502 Adenylylsulfate reductase A subunit                                        d1jnza1 A:503-643 Adenylylsulfate reductase A subunit                                                                                         SCOP domains
               CATH domains ----------1jnzA01 A:12-261,A:394-487,A:615-634  [code=3.50.50.60, no name defined]                                                                                                                                                                                  1jnzA02 A:262-393 Flavocytochrome C3; Chain A, domain 1                                                                             1jnzA01 A:12-261,A:394-487,A:615-634  [code=3.50.50.60, no name defined]                      1jnzA03 A:488-608  [code=1.20.58.100, no name defined]                                                                   ------1jnzA01             --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhh.eeeee..eeee..hhhhhhhhhhhhhhhh.....eeee..............eeee..............hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...................eeeee.hhhhhhhhhhhhhhh...ee..eeeeeeee.......eeeeeeee.....eeeee..eeee..............hhhhhh........hhhhhhhhhh...ee........eee......hhhhhhh....ee.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....eeehhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.......eeeee.............ee.........hhhhhh..............eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.hhhhh.eehhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.........ee............eeeeeeee....eeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1jnz A    2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDNNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641

Chain B from PDB  Type:PROTEIN  Length:149
 aligned with O28604_ARCFU | O28604 from UniProtKB/TrEMBL  Length:150

    Alignment length:149
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         
        O28604_ARCFU      2 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  150
               SCOP domains d1jnzb_ B: Adenylylsulfate reductase B subunit                                                                                                        SCOP domains
               CATH domains 1jnzB01 B:702-767  [code=3.30.70.20, no name defined]             ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.............hhhhhhh....eeee....eeee.hhhhh...hhhhhhh....eee...........eeeeee...eeeeeee.....eeeeeee..................hhhhhh.......hhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1jnz B  702 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  850
                                   711       721       731       741       751       761       771       781       791       801       811       821       831       841

Chain C from PDB  Type:PROTEIN  Length:642
 aligned with O28603_ARCFU | O28603 from UniProtKB/TrEMBL  Length:643

    Alignment length:642
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641  
        O28603_ARCFU      2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
               SCOP domains d1jnzc2 C:2002-2256,C:2402-2502 Adenylylsulfate reductase A subunit                                                                                                                                                                                            d1jnzc3 C:2257-2401 Adenylylsulfate reductase A subunit                                                                                          d1jnzc2 C:2002-2256,C:2402-2502 Adenylylsulfate reductase A subunit                                  d1jnzc1 C:2503-2643 Adenylylsulfate reductase A subunit                                                                                       SCOP domains
               CATH domains ----------1jnzC01 C:2012-2261,C:2394-2487,C:2615-2634  [code=3.50.50.60, no name defined]                                                                                                                                                                           1jnzC02 C:2262-2393 Flavocytochrome C3; Chain A, domain 1                                                                           1jnzC01 C:2012-2261,C:2394-2487,C:2615-2634  [code=3.50.50.60, no name defined]               1jnzC03 C:2488-2608  [code=1.20.58.100, no name defined]                                                                 ------1jnzC01             --------- CATH domains
           Pfam domains (1) ----------------------FAD_binding_2-1jnzC01 C:2024-2267                                                                                                                                                                                                                   -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Succ_DH_flav_C-1jnzC03 C:2519-2641                                                                                         -- Pfam domains (1)
           Pfam domains (2) ----------------------FAD_binding_2-1jnzC02 C:2024-2267                                                                                                                                                                                                                   -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Succ_DH_flav_C-1jnzC04 C:2519-2641                                                                                         -- Pfam domains (2)
         Sec.struct. author ..........hhhhh.eeeee..eeee..hhhhhhhhhhhhhhhhhh...eeeee.............eeee..............hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...................eeeee.hhhhhhhhhhhhhhh...eee.eeeeeeee.......eeeeeeee.....eeeee..eeee..............hhhhhh........hhhhhhhhhhh..ee........eee......hhhhhhh....ee.....hhhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhh....eeehhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh........eeeee.............ee.........hhhhhh..............eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.hhhhh.eehhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.........ee............eeeeeeee....eeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1jnz C 2002 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDNNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF 2643
                                  2011      2021      2031      2041      2051      2061      2071      2081      2091      2101      2111      2121      2131      2141      2151      2161      2171      2181      2191      2201      2211      2221      2231      2241      2251      2261      2271      2281      2291      2301      2311      2321      2331      2341      2351      2361      2371      2381      2391      2401      2411      2421      2431      2441      2451      2461      2471      2481      2491      2501      2511      2521      2531      2541      2551      2561      2571      2581      2591      2601      2611      2621      2631      2641

Chain D from PDB  Type:PROTEIN  Length:149
 aligned with O28604_ARCFU | O28604 from UniProtKB/TrEMBL  Length:150

    Alignment length:149
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         
        O28604_ARCFU      2 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  150
               SCOP domains d1jnzd_ D: Adenylylsulfate reductase B subunit                                                                                                        SCOP domains
               CATH domains 1jnzD01 D:2702-2767  [code=3.30.70.20, no name defined]           ----------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------Fer4-1jnzD01 D:2740-2763APS-reductase_C-1jnzD03 D:2764-2847                                                 --- Pfam domains (1)
           Pfam domains (2) --------------------------------------Fer4-1jnzD02 D:2740-2763APS-reductase_C-1jnzD04 D:2764-2847                                                 --- Pfam domains (2)
         Sec.struct. author .eee.............hhhhhhh....eeee....eeee.hhhhh...hhhhhhh....eee...........eeeeee...eeeeeee.....eeeeeee..................hhhhhh.......hhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1jnz D 2702 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA 2850
                                  2711      2721      2731      2741      2751      2761      2771      2781      2791      2801      2811      2821      2831      2841

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C (O28603_ARCFU | O28603)

molecular function
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B,D (O28604_ARCFU | O28604)


GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:310 - Pro A:311	[ RasMol ]
		Gln A:330 - Pro A:331	[ RasMol ]
		Gln C:2310 - Pro C:2311	[ RasMol ]
		Gln C:2330 - Pro C:2331	[ RasMol ]
		Glu B:834 - Pro B:835	[ RasMol ]
		Glu D:2834 - Pro D:2835	[ RasMol ]
		Lys A:304 - Pro A:305	[ RasMol ]
		Lys C:2304 - Pro C:2305	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Prepi
	protein: ribbon, secondary structure, chain-specific coloring; ligands: spacefill [ mono GIF format \| stereo GIF format ]
	protein: ribbon, secondary structure, chain-specific coloring; ligands: spacefill; white background [ mono GIF format \| stereo GIF format ]
	spacfill, chain-specific coloring [ mono GIF format \| stereo GIF format ]
	protein: C alpha trace, chain-specific coloring; ligands: spacefill [ mono GIF format \| stereo GIF format ]

Access by PDB/NDB ID
	1jnz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	O28603_ARCFU \| O28603
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	O28604_ARCFU \| O28604
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	1.8.99.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	O28603_ARCFU \| O28603
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	O28604_ARCFU \| O28604
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	O28603_ARCFU \| O28603	:	1jnr 2fja 2fjb 2fjd 2fje
	O28604_ARCFU \| O28604	:	1jnr 2fja 2fjb 2fjd 2fje

1jnr	1JNR CONTAINS THE SAME PROTEIN IN THE REDUCED STATE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (4, 8)

CATH Domains (4, 8)

Pfam Domains (4, 8)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File