Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ADENOSINE-5'-PHOSPHOSULFATE REDUCTASE IM COMPLEX WITH PRODUCTS
 
Authors :  A. Schiffer, G. Fritz, P. M. Kroneck, U. Ermler
Date :  02 Jan 06  (Deposition) - 28 Mar 06  (Release) - 31 Mar 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Aps Reductase, Sulfur Cycle, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Schiffer, G. Fritz, P. M. Kroneck, U. Ermler
Reaction Mechanism Of The Iron-Sulfur Flavoenzyme Adenosine-5'-Phosphosulfate Reductase Based On The Structural Characterization Of Different Enzymatic States
Biochemistry V. 45 2960 2006
PubMed-ID: 16503650  |  Reference-DOI: 10.1021/BI0521689
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ADENYLYLSULFATE REDUCTASE, SUBUNIT A
    Chains: A, C
    EC Number: 1.8.99.2
    Organism Scientific: ARCHAEOGLOBUS FULGIDUS
    Organism Taxid: 2234
    Synonym: APRA
 
Molecule 2 - ADENYLYLSULFATE REDUCTASE, SUBUNIT B
    Chains: B, D
    EC Number: 1.8.99.2
    Organism Scientific: ARCHAEOGLOBUS FULGIDUS
    Organism Taxid: 2234
    Synonym: APRB

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 10)

Asymmetric/Biological Unit (4, 10)
No.NameCountTypeFull Name
1AMP3Ligand/IonADENOSINE MONOPHOSPHATE
2NA1Ligand/IonSODIUM ION
3SF44Ligand/IonIRON/SULFUR CLUSTER
4SFD2Ligand/Ion(S)-10-((2S,3S,4R)-5-((S)-((S)-(((2R,3S,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3,4-DIHYDROXY-TETRAHYDROFURAN-2-YL)METHOXY)(HYDROXY)PHOSPHORYLOXY)(HYDROXY)PHOSPHORYLOXY)-2,3,4-TRIHYDROXYPENTYL)-7,8-DIMETHYL-2,4-DIOXO-2,3,4,4A-TETRAHYDROBENZO[G]PTERIDINE-5(10H)-SULFONIC ACID

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREAMP C:1301 , TYR C:2095 , GLN C:2145 , HOH C:7282BINDING SITE FOR RESIDUE NA C 8000
02AC2SOFTWAREGLY A:29 , GLY A:30 , GLY A:31 , PHE A:32 , SER A:33 , GLU A:56 , LYS A:57 , SER A:63 , GLY A:64 , ALA A:65 , VAL A:66 , LEU A:70 , ALA A:72 , ASN A:74 , PHE A:175 , ILE A:176 , ALA A:213 , THR A:214 , GLY A:215 , TRP A:234 , TYR A:235 , ALA A:236 , ASP A:239 , SER A:242 , ARG A:265 , SER A:397 , HIS A:398 , GLY A:438 , ASP A:439 , PHE A:448 , SER A:449 , SER A:452 , AMP A:1302 , HOH A:5041 , HOH A:5045 , HOH A:5121 , HOH A:5316 , HOH A:5321 , HOH A:5718 , HOH A:7001BINDING SITE FOR RESIDUE SFD A 1000
03AC3SOFTWAREAMP C:1301 , GLY C:2029 , GLY C:2030 , GLY C:2031 , PHE C:2032 , SER C:2033 , GLU C:2056 , LYS C:2057 , SER C:2063 , GLY C:2064 , ALA C:2065 , VAL C:2066 , LEU C:2070 , ALA C:2072 , ILE C:2073 , ASN C:2074 , PHE C:2175 , ILE C:2176 , ALA C:2213 , THR C:2214 , GLY C:2215 , TRP C:2234 , TYR C:2235 , ALA C:2236 , ASP C:2239 , SER C:2242 , ARG C:2265 , MET C:2365 , THR C:2366 , SER C:2397 , HIS C:2398 , GLY C:2438 , ASP C:2439 , PHE C:2448 , SER C:2449 , SER C:2452 , HOH C:5001 , HOH C:5008 , HOH C:5048 , HOH C:5059 , HOH C:5197 , HOH C:5320 , HOH C:5621 , TRP D:2748BINDING SITE FOR RESIDUE SFD C 3000
04AC4SOFTWARESER B:703 , CYS B:725 , ASN B:741 , CYS B:747 , TRP B:748 , GLU B:749 , CYS B:750 , TYR B:751 , CYS B:753BINDING SITE FOR RESIDUE SF4 B 1100
05AC5SOFTWARECYS B:710 , ASP B:711 , GLY B:712 , CYS B:713 , THR B:719 , ALA B:720 , CYS B:721 , CYS B:757 , ILE B:762BINDING SITE FOR RESIDUE SF4 B 1110
06AC6SOFTWARESER D:2703 , CYS D:2725 , PRO D:2726 , ASN D:2741 , CYS D:2747 , TRP D:2748 , CYS D:2750 , TYR D:2751 , CYS D:2753BINDING SITE FOR RESIDUE SF4 D 3100
07AC7SOFTWARECYS D:2710 , ASP D:2711 , GLY D:2712 , CYS D:2713 , THR D:2719 , ALA D:2720 , CYS D:2721 , CYS D:2757 , ILE D:2762BINDING SITE FOR RESIDUE SF4 D 3110
08AC8SOFTWARETYR C:2095 , GLN C:2145 , ARG C:2265 , VAL C:2273 , GLY C:2274 , LEU C:2278 , PRO C:2311 , ARG C:2317 , HIS C:2398 , PHE C:2448 , SFD C:3000 , HOH C:5013 , HOH C:5278 , HOH C:5422 , HOH C:5565 , HOH C:5597 , HOH C:7145 , HOH C:7370 , NA C:8000BINDING SITE FOR RESIDUE AMP C 1301
09AC9SOFTWARETYR A:95 , GLN A:145 , ARG A:265 , VAL A:273 , GLY A:274 , LEU A:278 , HIS A:398 , PHE A:448 , SFD A:1000 , AMP A:1303 , HOH A:5124 , HOH A:5375 , HOH A:5731 , HOH A:7595BINDING SITE FOR RESIDUE AMP A 1302
10BC1SOFTWAREPHE A:264 , PHE A:277 , CYS A:282 , ALA A:284 , TYR A:292 , ILE A:293 , ARG A:317 , ASN A:318 , VAL A:321 , AMP A:1302 , HOH A:5583 , HOH A:5683 , HOH A:7593 , HOH A:7597BINDING SITE FOR RESIDUE AMP A 1303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FJB)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Lys A:304 -Pro A:305
2Gln A:310 -Pro A:311
3Gln A:330 -Pro A:331
4Lys C:2304 -Pro C:2305
5Gln C:2310 -Pro C:2311
6Gln C:2330 -Pro C:2331
7Glu B:834 -Pro B:835
8Glu D:2834 -Pro D:2835

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FJB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FJB)

(-) Exons   (0, 0)

(no "Exon" information available for 2FJB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:642
 aligned with O28603_ARCFU | O28603 from UniProtKB/TrEMBL  Length:643

    Alignment length:642
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641  
        O28603_ARCFU      2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ----------2fjbA01 A:12-261,A:394-487,A:615-634  [code=3.50.50.60, no name defined]                                                                                                                                                                                  2fjbA02 A:262-393 Flavocytochrome C3; Chain A, domain 1                                                                             2fjbA01 A:12-261,A:394-487,A:615-634  [code=3.50.50.60, no name defined]                      2fjbA03 A:488-608  [code=1.20.58.100, no name defined]                                                                   ------2fjbA01             --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhh.eeeee..eeee..hhhhhhhhhhhhhhhh.....eeee..............eeee..............hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...................eeeee.hhhhhhhhhhhhhhh...ee..eeeeeeeee..eeeeeeeeeeee.....eeeee..eeee..............hhhhhh........hhhhhhhhhh...ee........eee......hhhhhhh....ee.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....eeehhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh........eeeee.............ee.........hhhhhh..............eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.hhhhh.eehhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.........ee............eeeeeeee....eeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2fjb A    2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641  


Chain B from PDB  Type:PROTEIN  Length:149
 aligned with O28604_ARCFU | O28604 from UniProtKB/TrEMBL  Length:150

    Alignment length:149
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         
        O28604_ARCFU      2 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  150
               SCOP domains d2fjbb_ B: Adenylylsulfate reductase B subunit                                                                                                        SCOP domains
               CATH domains 2fjbB01 B:702-767  [code=3.30.70.20, no name defined]             ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.............hhhhhhh....eeee....eeee.hhhhh...hhhhhhh....eee...........eeeeee...eeeeeee.....eeeeeee..................hhhhhh.......hhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2fjb B  702 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  850
                                   711       721       731       741       751       761       771       781       791       801       811       821       831       841         


Chain C from PDB  Type:PROTEIN  Length:642
 aligned with O28603_ARCFU | O28603 from UniProtKB/TrEMBL  Length:643

    Alignment length:642
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641  
        O28603_ARCFU      2 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF  643
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ----------2fjbC01 C:2012-2261,C:2394-2487,C:2615-2634  [code=3.50.50.60, no name defined]                                                                                                                                                                           2fjbC02 C:2262-2393 Flavocytochrome C3; Chain A, domain 1                                                                           2fjbC01 C:2012-2261,C:2394-2487,C:2615-2634  [code=3.50.50.60, no name defined]               2fjbC03 C:2488-2608  [code=1.20.58.100, no name defined]                                                                 ------2fjbC01             --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhh.eeeee..eeee..hhhhhhhhhhhhhhhhhhh..eeee..............eeee..............hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...................eeeee.hhhhhhhhhhhhhhh...ee..eeeeeeee.......eeeeeeee.....eeeee..eeee..............hhhhhh........hhhhhhhhhhh..ee........eee......hhhhhhh....ee.....hhhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhhh...eeehhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh........eeeee.............ee.........hhhhhh..............eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.hhhhh.eehhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.........ee............eeeeeeee....eeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2fjb C 2002 VYYPKKYELYKADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGLPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKDKNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGATLLFRPRSTGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQFEHRFIPFRFKDGYGPVGAWFLFFKCKAKNAYGEEYIKTRAAELEKYKPYGAAQPIPTPLRNHQVMLEIMDGNQPIYMHTEEALAELAGGDKKKLKHIYEEAFEDFLDMTVSQALLWACQNIDPQEQPSEAAPAEPYIMGSHSGEAGFWVCGPEDLMPEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHKFSSGSFTEGRIAAKAAVRFILEQKPNPEIDDAVVEELKKKAYAPMERFMQYKDLSTADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF 2643
                                  2011      2021      2031      2041      2051      2061      2071      2081      2091      2101      2111      2121      2131      2141      2151      2161      2171      2181      2191      2201      2211      2221      2231      2241      2251      2261      2271      2281      2291      2301      2311      2321      2331      2341      2351      2361      2371      2381      2391      2401      2411      2421      2431      2441      2451      2461      2471      2481      2491      2501      2511      2521      2531      2541      2551      2561      2571      2581      2591      2601      2611      2621      2631      2641  


Chain D from PDB  Type:PROTEIN  Length:149
 aligned with O28604_ARCFU | O28604 from UniProtKB/TrEMBL  Length:150

    Alignment length:149
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         
        O28604_ARCFU      2 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA  150
               SCOP domains d2fjbd_ D: Adenylylsulfate reductase B subunit                                                                                                        SCOP domains
               CATH domains 2fjbD01 D:2702-2767  [code=3.30.70.20, no name defined]           ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.............hhhhhhh....eeee....eeee.hhhhh...hhhhhhh....eee...........eeeeee...eeeeeee.....eeeeeee..................hhhhhh.......hhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2fjb D 2702 PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA 2850
                                  2711      2721      2731      2741      2751      2761      2771      2781      2791      2801      2811      2821      2831      2841
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (4, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FJB)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,C   (O28603_ARCFU | O28603)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B,D   (O28604_ARCFU | O28604)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SFD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:310 - Pro A:311   [ RasMol ]  
    Gln A:330 - Pro A:331   [ RasMol ]  
    Gln C:2310 - Pro C:2311   [ RasMol ]  
    Gln C:2330 - Pro C:2331   [ RasMol ]  
    Glu B:834 - Pro B:835   [ RasMol ]  
    Glu D:2834 - Pro D:2835   [ RasMol ]  
    Lys A:304 - Pro A:305   [ RasMol ]  
    Lys C:2304 - Pro C:2305   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fjb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O28603_ARCFU | O28603
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  O28604_ARCFU | O28604
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.8.99.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O28603_ARCFU | O28603
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  O28604_ARCFU | O28604
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        O28603_ARCFU | O28603: 1jnr 1jnz 2fja 2fjd 2fje
        O28604_ARCFU | O28604: 1jnr 1jnz 2fja 2fjd 2fje

(-) Related Entries Specified in the PDB File

1jnr 1jnz 2fja 2fjd 2fje