1IUR - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   DNAJ DOMAIN OF HUMAN KIAA0730 PROTEIN

Authors :   N. Kobayashi, S. Koshiba, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   07 Mar 02 (Deposition) - 07 Oct 03 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Dnaj Like Domain, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. Kobayashi, S. Koshiba, T. Kigawa, S. Yokoyama
Solution Structure Of Dnaj Domain Of Human Kiaa0730 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - KIAA0730 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P010905-02
	Expression System Vector Type	:	PLASMID
	Fragment	:	DNAJ DOMAIN
	Gene	:	AB018273
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1IUR)

(no "Site" information available for 1IUR)

(no "SS Bond" information available for 1IUR)

(no "Cis Peptide Bond" information available for 1IUR)

NMR Structure (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_064823	R	4331	Q	SACS_HUMAN	Disease (SACS)	773009784	A	R	39	Q
2	UniProt	VAR_064824	E	4343	K	SACS_HUMAN	Disease (SACS)	749383532	A	E	51	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	DNAJ_2	PS50076	dnaJ domain profile.	SACS_HUMAN	4306-4393	1	A:14-88

NMR Structure (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2b	ENST00000382292	2b	ENSE00001548892	chr13:23985652-23985359	294	SACS_HUMAN	1-7	7	0	-	-
1.4	ENST00000382292	4	ENSE00001762476	chr13:23949408-23949258	151	SACS_HUMAN	7-57	51	0	-	-
1.5	ENST00000382292	5	ENSE00001749661	chr13:23945304-23945217	88	SACS_HUMAN	58-87	30	0	-	-
1.6a	ENST00000382292	6a	ENSE00001794623	chr13:23942626-23942541	86	SACS_HUMAN	87-115	29	0	-	-
1.7	ENST00000382292	7	ENSE00001738413	chr13:23939416-23939305	112	SACS_HUMAN	116-153	38	0	-	-
1.8	ENST00000382292	8	ENSE00001764306	chr13:23932620-23932474	147	SACS_HUMAN	153-202	50	0	-	-
1.9a	ENST00000382292	9a	ENSE00001739205	chr13:23930146-23928658	1489	SACS_HUMAN	202-698	497	0	-	-
1.10a	ENST00000382292	10a	ENSE00001745943	chr13:23928015-23927924	92	SACS_HUMAN	698-729	32	0	-	-
1.11b	ENST00000382292	11b	ENSE00001731339	chr13:23915829-23902965	12865	SACS_HUMAN	729-4579	3851	1	A:1-88 (gaps)	95

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:88
 aligned with SACS_HUMAN | Q9NZJ4 from UniProtKB/Swiss-Prot  Length:4579

    Alignment length:95
                                  4295      4305      4315      4325      4335      4345      4355      4365      4375     
          SACS_HUMAN   4286 HKTSSKHQSPKKLKVNSLPEILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF 4380
               SCOP domains d1iura_ A:        Hypothetical protein KIAA0730                                                 SCOP domains
               CATH domains -------------------1iurA01 A:13-75  [code=1.10.287.110, no name defined]          ------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........-------..hhhhhhhhhhhh....hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------Q-----------K------------------------------------- SAPs(SNPs)
                    PROSITE --------------------DNAJ_2  PDB: A:14-88 UniProt: 4306-4393                                     PROSITE
               Transcript 1 Exon 1.11b  PDB: A:1-88 (gaps) UniProt: 729-4579 [INCOMPLETE]                                   Transcript 1
                1iur A    1 MHHHHHHLVPR-------GSILKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTF   88
                                    10|       13        23        33        43        53        63        73        83     
                                     11      12

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Long alpha-hairpin (315)

Superfamily: Chaperone J-domain (31)

Family: Chaperone J-domain (16)

Protein domain: Hypothetical protein KIAA0730 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1iura_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helix Hairpins (718)

Homologous Superfamily: [code=1.10.287.110, no name defined] (21)

Human (Homo sapiens) (3)

1iurA01

A:13-75

(no "Pfam Domain" information available for 1IUR)

NMR Structure(hide GO term definitions)

Chain A (SACS_HUMAN | Q9NZJ4)

molecular function
	GO:0030544	Hsp70 protein binding	Interacting selectively and non-covalently with Hsp70 proteins, any of a group of heat shock proteins around 70kDa in size.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0070628	proteasome binding	Interacting selectively and non-covalently with a proteasome, a large multisubunit protein complex that catalyzes protein degradation.
biological process
	GO:0090084	negative regulation of inclusion body assembly	Any process that decreases the rate, frequency, or extent of inclusion body assembly. Inclusion body assembly is the aggregation, arrangement and bonding together of a set of components to form an inclusion body.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
cellular component
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0070852	cell body fiber	A neuron projection that is found in unipolar neurons and corresponds to the region between the cell body and the point at which the single projection branches.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1iur)

	Sites
(no "Sites" information available for 1iur)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1iur)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1iur
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SACS_HUMAN \| Q9NZJ4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	270550
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SACS_HUMAN \| Q9NZJ4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SACS_HUMAN \| Q9NZJ4	:	3o10 5v44 5v45 5v46 5vsx 5vsz

(no "Related Entries Specified in the PDB File" available for 1IUR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (1, 1)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File