|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 1I54) |
(no "Cis Peptide Bond" information available for 1I54) |
(no "SAP(SNP)/Variant" information available for 1I54) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1I54) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:103 10 20 30 40 50 60 70 80 90 100 CYC_THUAA 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d1i54a_ A: Mitochondrial cytochrome c SCOP domains CATH domains 1i54A00 A:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: A:1-102 UniProt: 1-102 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1i54 A 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:103 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:103 10 20 30 40 50 60 70 80 90 100 CYC_THUAA 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d1i54b_ B: Mitochondrial cytochrome c SCOP domains CATH domains 1i54B00 B:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: B:1-102 UniProt: 1-102 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1i54 B 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1I54) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC_THUAA | P81459)
|
|
|
|
|
|
|