1I0Z - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   HUMAN HEART L-LACTATE DEHYDROGENASE H CHAIN, TERNARY COMPLEX WITH NADH AND OXAMATE

Authors :   J. A. Read, V. J. Winter, C. M. Eszes, R. B. Sessions, R. L. Brady

Date :   30 Jan 01 (Deposition) - 28 Mar 01 (Release) - 12 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Dehydrogenase, Rossmann Fold, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. A. Read, V. J. Winter, C. M. Eszes, R. B. Sessions, R. L. Brady
Structural Basis For Altered Activity Of M- And H-Isozyme Forms Of Human Lactate Dehydrogenase.
Proteins V. 43 175 2001
PubMed-ID: 11276087 | Reference-DOI: 10.1002/1097-0134(20010501)43:2<175::AID-PROT1029>3 .0.CO;2-#

Molecule 1 - L-LACTATE DEHYDROGENASE H CHAIN
	Chains	:	A, B
	EC Number	:	1.1.1.27
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PKK223-3
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	LDHB
	Organ	:	HEART
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	LDH-B

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	NAI	2	Ligand/Ion	1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
2	OXM	2	Ligand/Ion	OXAMIC ACID

Biological Unit 1 (2, 8)

No.	Name	Count	Type	Full Name
1	NAI	4	Ligand/Ion	1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
2	OXM	4	Ligand/Ion	OXAMIC ACID

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:29 , GLN A:30 , VAL A:31 , ASP A:52 , VAL A:53 , LEU A:54 , THR A:95 , ALA A:96 , GLY A:97 , VAL A:98 , ARG A:99 , VAL A:136 , SER A:137 , ASN A:138 , SER A:161 , LEU A:165 , HIS A:193 , THR A:248 , ILE A:252 , OXM A:402 , HOH A:410 , HOH A:413 , HOH A:454 , HOH A:462 , HOH A:477 , HOH A:480 , HOH A:498 , HOH A:500 , HOH A:502 , HOH A:503 , HOH A:523 , HOH A:546	BINDING SITE FOR RESIDUE NAI A 401
2	AC2	SOFTWARE	GLN A:100 , ARG A:106 , ASN A:138 , ARG A:169 , HIS A:193 , ALA A:238 , THR A:248 , NAI A:401	BINDING SITE FOR RESIDUE OXM A 402
3	AC3	SOFTWARE	ASN A:108 , GLY B:29 , GLN B:30 , VAL B:31 , ASP B:52 , VAL B:53 , LEU B:54 , THR B:95 , ALA B:96 , GLY B:97 , VAL B:98 , ARG B:99 , ILE B:120 , VAL B:136 , ASN B:138 , SER B:161 , LEU B:165 , HIS B:193 , THR B:248 , ILE B:252 , OXM B:412 , HOH B:419 , HOH B:433 , HOH B:438 , HOH B:470 , HOH B:480 , HOH B:498 , HOH B:534	BINDING SITE FOR RESIDUE NAI B 411
4	AC4	SOFTWARE	GLN B:100 , ARG B:106 , ASN B:138 , ARG B:169 , HIS B:193 , ALA B:238 , THR B:248 , NAI B:411	BINDING SITE FOR RESIDUE OXM B 412

(no "SS Bond" information available for 1I0Z)

Asymmetric Unit

No.	Residues
1	Asn A:138	-	Pro A:139
2	Glu A:225	-	Asn A:226
3	Asn B:138	-	Pro B:139

Asymmetric Unit (12, 24)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_004173	K	7	E	LDHB_HUMAN	Disease (LDHBD)	118203897	A/B	K	6	E
02	UniProt	VAR_004174	A	35	E	LDHB_HUMAN	Disease (LDHBD)	---	A/B	A	34	E
03	UniProt	VAR_011634	G	69	E	LDHB_HUMAN	Disease (LDHBD)	---	A/B	G	68	E
04	UniProt	VAR_011635	R	107	W	LDHB_HUMAN	Disease (LDHBD)	777954556	A/B	R	106	W
05	UniProt	VAR_004175	S	129	R	LDHB_HUMAN	Disease (LDHBD)	118203896	A/B	S	128	R
06	UniProt	VAR_004176	F	171	V	LDHB_HUMAN	Disease (LDHBD)	---	A/B	F	170	V
07	UniProt	VAR_004177	R	172	H	LDHB_HUMAN	Disease (LDHBD)	118203895	A/B	R	171	H
08	UniProt	VAR_011636	R	172	P	LDHB_HUMAN	Disease (LDHBD)	---	A/B	R	171	P
09	UniProt	VAR_004178	M	175	L	LDHB_HUMAN	Disease (LDHBD)	---	A/B	M	174	L
10	UniProt	VAR_049758	M	175	V	LDHB_HUMAN	Polymorphism	7966339	A/B	M	174	V
11	UniProt	VAR_004179	D	322	V	LDHB_HUMAN	Disease (LDHBD)	---	A/B	D	321	V
12	UniProt	VAR_011638	W	325	R	LDHB_HUMAN	Disease (LDHBD)	267607212	A/B	W	324	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (12, 48)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_004173	K	7	E	LDHB_HUMAN	Disease (LDHBD)	118203897	A/B	K	6	E
02	UniProt	VAR_004174	A	35	E	LDHB_HUMAN	Disease (LDHBD)	---	A/B	A	34	E
03	UniProt	VAR_011634	G	69	E	LDHB_HUMAN	Disease (LDHBD)	---	A/B	G	68	E
04	UniProt	VAR_011635	R	107	W	LDHB_HUMAN	Disease (LDHBD)	777954556	A/B	R	106	W
05	UniProt	VAR_004175	S	129	R	LDHB_HUMAN	Disease (LDHBD)	118203896	A/B	S	128	R
06	UniProt	VAR_004176	F	171	V	LDHB_HUMAN	Disease (LDHBD)	---	A/B	F	170	V
07	UniProt	VAR_004177	R	172	H	LDHB_HUMAN	Disease (LDHBD)	118203895	A/B	R	171	H
08	UniProt	VAR_011636	R	172	P	LDHB_HUMAN	Disease (LDHBD)	---	A/B	R	171	P
09	UniProt	VAR_004178	M	175	L	LDHB_HUMAN	Disease (LDHBD)	---	A/B	M	174	L
10	UniProt	VAR_049758	M	175	V	LDHB_HUMAN	Polymorphism	7966339	A/B	M	174	V
11	UniProt	VAR_004179	D	322	V	LDHB_HUMAN	Disease (LDHBD)	---	A/B	D	321	V
12	UniProt	VAR_011638	W	325	R	LDHB_HUMAN	Disease (LDHBD)	267607212	A/B	W	324	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L_LDH	PS00064	L-lactate dehydrogenase active site.	LDHB_HUMAN	191-197	2	A:190-196 B:190-196

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	L_LDH	PS00064	L-lactate dehydrogenase active site.	LDHB_HUMAN	191-197	4	A:190-196 B:190-196

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1d	ENST00000396076	1d	ENSE00001523775	chr12:21810728-21810402	327	LDHB_HUMAN	-	0	0	-	-
1.4a	ENST00000396076	4a	ENSE00000822271	chr12:21807611-21807477	135	LDHB_HUMAN	1-43	43	2	A:1-42 B:1-42	42 42
1.5	ENST00000396076	5	ENSE00000726205	chr12:21799950-21799833	118	LDHB_HUMAN	44-83	40	2	A:43-82 B:43-82	40 40
1.6b	ENST00000396076	6b	ENSE00000726202	chr12:21797042-21796869	174	LDHB_HUMAN	83-141	59	2	A:82-140 B:82-140	59 59
1.7	ENST00000396076	7	ENSE00000726197	chr12:21795059-21794886	174	LDHB_HUMAN	141-199	59	2	A:140-198 B:140-198	59 59
1.8b	ENST00000396076	8b	ENSE00000726193	chr12:21791404-21791287	118	LDHB_HUMAN	199-238	40	2	A:198-237 B:198-237	40 40
1.9	ENST00000396076	9	ENSE00000726188	chr12:21790128-21790005	124	LDHB_HUMAN	238-279	42	2	A:237-278 B:237-278	42 42
1.10b	ENST00000396076	10b	ENSE00000994921	chr12:21788643-21788276	368	LDHB_HUMAN	280-334	55	2	A:279-332 B:279-332	54 54

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:332
 aligned with LDHB_HUMAN | P07195 from UniProtKB/Swiss-Prot  Length:334

    Alignment length:332
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331  
           LDHB_HUMAN     2 ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKD 333
               SCOP domains d1i0za1 A:1-160 Lactate dehydrogenase                                                                                                                           d1i0za2 A:161-332 Lactate dehydrogenase                                                                                                                                      SCOP domains
               CATH domains --------------1i0zA01 A:15-162 NAD(P)-binding Rossmann-like Domain                                                                                                1i0zA02 A:163-330 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                             -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh.............eeeee..hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhhhhhh...eeee..hhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhhhh.hhhhh...ee.......ee.hhh.ee..eehhhhh...........hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) -----E---------------------------E---------------------------------E-------------------------------------W---------------------R-----------------------------------------VH--L--------------------------------------------------------------------------------------------------------------------------------------------------V--R-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--V-------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a  PDB: A:1-42 UniProt: 1-43      Exon 1.5  PDB: A:43-82 UniProt: 44-83   ---------------------------------------------------------Exon 1.7  PDB: A:140-198 UniProt: 141-199                  --------------------------------------Exon 1.9  PDB: A:237-278 UniProt: 238-279 Exon 1.10b  PDB: A:279-332 UniProt: 280-334            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------Exon 1.6b  PDB: A:82-140 UniProt: 83-141                   ---------------------------------------------------------Exon 1.8b  PDB: A:198-237               ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1i0z A   1 ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKD 332
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Chain B from PDB  Type:PROTEIN  Length:332
 aligned with LDHB_HUMAN | P07195 from UniProtKB/Swiss-Prot  Length:334

    Alignment length:332
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331  
           LDHB_HUMAN     2 ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKD 333
               SCOP domains d1i0zb1 B:1-160 Lactate dehydrogenase                                                                                                                           d1i0zb2 B:161-332 Lactate dehydrogenase                                                                                                                                      SCOP domains
               CATH domains --------------1i0zB01 B:15-162 NAD(P)-binding Rossmann-like Domain                                                                                                1i0zB02 B:163-330 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                             -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh.............eeeee..hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhhhhhh....eee..hhhhhh...eeee...........hhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhhhh.hhh.ee..ee.......ee.hhh.ee..eehhhhh..........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) -----E---------------------------E---------------------------------E-------------------------------------W---------------------R-----------------------------------------VH--L--------------------------------------------------------------------------------------------------------------------------------------------------V--R-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--V-------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L_LDH  ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a  PDB: B:1-42 UniProt: 1-43      Exon 1.5  PDB: B:43-82 UniProt: 44-83   ---------------------------------------------------------Exon 1.7  PDB: B:140-198 UniProt: 141-199                  --------------------------------------Exon 1.9  PDB: B:237-278 UniProt: 238-279 Exon 1.10b  PDB: B:279-332 UniProt: 280-334            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------Exon 1.6b  PDB: B:82-140 UniProt: 83-141                   ---------------------------------------------------------Exon 1.8b  PDB: B:198-237               ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1i0z B   1 ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKD 332
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

1a	1i0zA01	A:15-162
1b	1i0zB01	B:15-162

Architecture: Alpha-Beta Complex (3881)

Topology: L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 (116)

Homologous Superfamily: L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2 (116)

Human (Homo sapiens) (4)

2a	1i0zA02	A:163-330
2b	1i0zB02	B:163-330

(no "Pfam Domain" information available for 1I0Z)

Asymmetric Unit(hide GO term definitions)

Chain A,B (LDHB_HUMAN | P07195)

molecular function
	GO:0004459	L-lactate dehydrogenase activity	Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0004457	lactate dehydrogenase activity	Catalysis of the reaction: lactate + NAD+ = H+ + NADH + pyruvate.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0019674	NAD metabolic process	The chemical reactions and pathways involving nicotinamide adenine dinucleotide (NAD), a coenzyme present in most living cells and derived from the B vitamin nicotinic acid.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0019752	carboxylic acid metabolic process	The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
	GO:0006089	lactate metabolic process	The chemical reactions and pathways involving lactate, the anion of lactic acid.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006090	pyruvate metabolic process	The chemical reactions and pathways involving pyruvate, 2-oxopropanoate.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OXM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:138 - Pro A:139	[ RasMol ]
		Asn B:138 - Pro B:139	[ RasMol ]
		Glu A:225 - Asn A:226	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1i0z
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LDHB_HUMAN \| P07195
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.27
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	614128
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LDHB_HUMAN \| P07195
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LDHB_HUMAN \| P07195	:	1t2f

1i10	HUMAN HEART LDH
1ldg	PLASMODIUM FALCIPARUM LDH
5ldh	PIG HEART LDH
9ldt	PIG MUSCLE LDH

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (12, 24)

PROSITE Motifs (1, 2)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (22, 22)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File