|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1H7V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1H7V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1H7V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1H7V) |
Exons (0, 0)| (no "Exon" information available for 1H7V) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:60 aligned with Q9XG40_GUITH | Q9XG40 from UniProtKB/TrEMBL Length:159 Alignment length:60 66 76 86 96 106 116 Q9XG40_GUITH 57 MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI 116 SCOP domains d1h7va_ A: Rubredoxin SCOP domains CATH domains 1h7vA00 A:1-60 [code=2.20.28.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 1h7v A 1 MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI 60 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1H7V) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (Q9XG40_GUITH | Q9XG40)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|