|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1FI3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1FI3) |
SAPs(SNPs)/Variants (9, 9)
NMR Structure (9, 9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1FI3) |
Exons (0, 0)| (no "Exon" information available for 1FI3) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:82 aligned with CY551_PSEST | P00101 from UniProtKB/Swiss-Prot Length:104 Alignment length:82 32 42 52 62 72 82 92 102 CY551_PSEST 23 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK 104 SCOP domains d1fi3a_ A: Cytochrome c551 SCOP domains CATH domains 1fi3A00 A:1-82 Cytochrome c CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------I-A-L----F------Y--------L--G-------------------------------I--Q- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 1fi3 A 1 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPHPPNPVTEEEAKILAEWVLSLK 82 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1FI3) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (CY551_PSEST | P00101)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|