2I8F - JenaLib

Title :   SOLUTION CONFORMATION OF THE H47A MUTANT OF PSEUDOMONAS STUTZERI ZOBELL FERROCYTOCHROME C-551

Authors :   Q. Liang, R. Timkovich

Date :   01 Sep 06 (Deposition) - 05 Jun 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Helix-Turn-Helix, Cytochrome, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Q. Liang, G. T. Miller, C. A. Beeghley, C. B. Graf, R. Timkovich
Solution Conformation Of The His-47 To Ala-47 Mutant Of Pseudomonas Stutzeri Zobell Ferrocytochrome C-551.
Biophys. J. V. 93 1700 2007
PubMed-ID: 17496029 | Reference-DOI: 10.1529/BIOPHYSJ.106.102772
(for further references see the PDB file header)

Compounds

Molecule 1 - CYTOCHROME C-551
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PBR329
	Expression System Strain	:	UT5600
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	NIRM
	Mutation	:	YES
	Organism Scientific	:	PSEUDOMONAS STUTZERI ZOBELL
	Organism Taxid	:	96564
	Strain	:	ZOBELL
	Synonym	:	CYTOCHROME C551, CYTOCHROME C8

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 9)

NMR Structure (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CY551_PSEST_001 *	V	40	I	CY551_PSEST	---	---	A	V	18	I
2	UniProt	VAR_CY551_PSEST_002 *	T	42	A	CY551_PSEST	---	---	A	T	20	A
3	UniProt	VAR_CY551_PSEST_003 *	M	44	L	CY551_PSEST	---	---	A	M	22	L
4	UniProt	VAR_CY551_PSEST_004 *	L	49	F	CY551_PSEST	---	---	A	L	27	F
5	UniProt	VAR_CY551_PSEST_005 *	N	56	Y	CY551_PSEST	---	---	A	N	34	Y
6	UniProt	VAR_CY551_PSEST_006 *	T	65	L	CY551_PSEST	---	---	A	T	43	L
7	UniProt	VAR_CY551_PSEST_007 *	L	68	G	CY551_PSEST	---	---	A	L	46	G
8	UniProt	VAR_CY551_PSEST_008 *	V	100	I	CY551_PSEST	---	---	A	V	78	I
9	UniProt	VAR_CY551_PSEST_009 *	L	103	Q	CY551_PSEST	---	---	A	L	81	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:82
 aligned with CY551_PSEST | P00101 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:82
                                    32        42        52        62        72        82        92       102  
          CY551_PSEST    23 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK 104
               SCOP domains d2i8fa_ A: automated matches                                                       SCOP domains
               CATH domains 2i8fA00 A:1-82 Cytochrome c                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh...............hhhhhhhhh....hhhhhhhhhhhh................hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------I-A-L----F------Y--------L--G-------------------------------I--Q- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2i8f A   1 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALAIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK  82
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

NMR Structure(hide GO term definitions)

Chain A (CY551_PSEST | P00101)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i8f)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2i8f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CY551_PSEST \| P00101
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CY551_PSEST \| P00101
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description