Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION CONFORMATION OF CYTOCHROME C-551 FROM P.STUTZERI ZOBELL DETERMINED BY NMR+
 
Authors :  M. Cai, R. Timkovich
Date :  25 Feb 94  (Deposition) - 30 Apr 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Cai, E. G. Bradford, R. Timkovich
Investigation Of The Solution Conformation Of Cytochrome C-551 From Pseudomonas Stutzeri.
Biochemistry V. 31 8603 1992
PubMed-ID: 1327105  |  Reference-DOI: 10.1021/BI00151A030
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C551
    ChainsA
    EngineeredYES
    Organism ScientificPSEUDOMONAS STUTZERI
    Organism Taxid316

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:12 , CYS A:15 , HIS A:16 , LEU A:44 , HIS A:47 , ILE A:48 , SER A:52 , GLN A:53 , GLY A:54 , VAL A:55 , TRP A:56 , GLY A:57 , ILE A:59 , MET A:61 , PRO A:62 , ASN A:64 , VAL A:66BINDING SITE FOR RESIDUE HEM A 83

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CCH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CCH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (9, 9)

NMR Structure (9, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CY551_PSEST_001 *V40ICY551_PSEST  ---  ---AV18I
2UniProtVAR_CY551_PSEST_002 *T42ACY551_PSEST  ---  ---AT20A
3UniProtVAR_CY551_PSEST_003 *M44LCY551_PSEST  ---  ---AM22L
4UniProtVAR_CY551_PSEST_004 *L49FCY551_PSEST  ---  ---AL27F
5UniProtVAR_CY551_PSEST_005 *N56YCY551_PSEST  ---  ---AN34Y
6UniProtVAR_CY551_PSEST_006 *T65LCY551_PSEST  ---  ---AT43L
7UniProtVAR_CY551_PSEST_007 *L68GCY551_PSEST  ---  ---AL46G
8UniProtVAR_CY551_PSEST_008 *V100ICY551_PSEST  ---  ---AV78I
9UniProtVAR_CY551_PSEST_009 *L103QCY551_PSEST  ---  ---AL81Q
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1CCH)

(-) Exons   (0, 0)

(no "Exon" information available for 1CCH)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:82
 aligned with CY551_PSEST | P00101 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:82
                                    32        42        52        62        72        82        92       102  
          CY551_PSEST    23 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK 104
               SCOP domains d1ccha_ A: Cytochrome c551                                                         SCOP domains
               CATH domains 1cchA00 A:1-82 Cytochrome c                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..............hhhhhhhhhh......hhhhhhhhhh.........hhhhh.....hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------I-A-L----F------Y--------L--G-------------------------------I--Q- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 1cch A   1 QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK  82
                                    10        20        30        40        50        60        70        80  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CCH)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (CY551_PSEST | P00101)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cch)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cch
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CY551_PSEST | P00101
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CY551_PSEST | P00101
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CY551_PSEST | P001011cor 1fi3 2i8f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CCH)