1FBR - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   FOURTH AND FIFTH FIBRONECTIN TYPE I MODULE PAIR

Authors :   I. Q. H. Phan, M. J. Williams, I. D. Campbell

Date :   08 Aug 95 (Deposition) - 15 Oct 95 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Cell Adhesion Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Williams, I. Phan, T. S. Harvey, A. Rostagno, L. I. Gold, I. D. Campbell
Solution Structure Of A Pair Of Fibronectin Type 1 Modules With Fibrin Binding Activity.
J. Mol. Biol. V. 235 1302 1994
PubMed-ID: 8308892 | Reference-DOI: 10.1006/JMBI.1994.1083
(for further references see the PDB file header)

Molecule 1 - FIBRONECTIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SACCHAROMYCES CEREVISIAE
	Expression System Common	:	BAKER'S YEAST
	Expression System Gene	:	HUMAN FIBRONECTIN
	Expression System Plasmid	:	PMA91
	Expression System Taxid	:	4932
	Gene	:	HUMAN FIBRONECTIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	EXTRACELLULAR
	Tissue	:	PLASMA


NMR Structure	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1FBR)

(no "Site" information available for 1FBR)

NMR Structure

No.	Residues
1	A:4	-	A:33
2	A:31	-	A:43
3	A:49	-	A:78
4	A:76	-	A:88

(no "Cis Peptide Bond" information available for 1FBR)

(no "SAP(SNP)/Variant" information available for 1FBR)

NMR Structure (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN1_2	PS51091	Fibronectin type-I domain profile.	FINC_HUMAN	50-90 95-138 139-182 184-228 229-273 306-345 468-511 516-558 559-602 2204-2248 2249-2291 2293-2333	2	- - - A:2-46 A:47-91 - - - - - - -
2	FN1_1	PS01253	Fibronectin type-I domain signature.	FINC_HUMAN	52-87 97-135 141-179 186-225 231-270 308-342 470-508 518-555 561-599 2206-2245 2251-2288 2295-2330	2	- - - A:4-43 A:49-88 - - - - - - -

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000359671	1c	ENSE00001245714	chr2:216300791-216300378	414	FINC_HUMAN	1-50	50	0	-	-
1.2	ENST00000359671	2	ENSE00001342487	chr2:216299547-216299419	129	FINC_HUMAN	50-93	44	0	-	-
1.3	ENST00000359671	3	ENSE00001146266	chr2:216298184-216298047	138	FINC_HUMAN	93-139	47	0	-	-
1.4	ENST00000359671	4	ENSE00001342465	chr2:216296687-216296556	132	FINC_HUMAN	139-183	45	1	A:1-1	1
1.5	ENST00000359671	5	ENSE00001342461	chr2:216295575-216295438	138	FINC_HUMAN	183-229	47	1	A:1-47	47
1.6	ENST00000359671	6	ENSE00001146236	chr2:216293061-216292903	159	FINC_HUMAN	229-282	54	1	A:47-93	47
1.7	ENST00000359671	7	ENSE00001245674	chr2:216290008-216289817	192	FINC_HUMAN	282-346	65	0	-	-
1.8	ENST00000359671	8	ENSE00001245669	chr2:216289048-216288869	180	FINC_HUMAN	346-406	61	0	-	-
1.9	ENST00000359671	9	ENSE00001146209	chr2:216288249-216288073	177	FINC_HUMAN	406-465	60	0	-	-
1.10	ENST00000359671	10	ENSE00001245657	chr2:216286966-216286814	153	FINC_HUMAN	465-516	52	0	-	-
1.11b	ENST00000359671	11b	ENSE00001342442	chr2:216285524-216285396	129	FINC_HUMAN	516-559	44	0	-	-
1.12b	ENST00000359671	12b	ENSE00001146180	chr2:216284108-216283965	144	FINC_HUMAN	559-607	49	0	-	-
1.13a	ENST00000359671	13a	ENSE00001223232	chr2:216279681-216279560	122	FINC_HUMAN	607-647	41	0	-	-
1.14a	ENST00000359671	14a	ENSE00001342433	chr2:216274837-216274657	181	FINC_HUMAN	648-708	61	0	-	-
1.14c	ENST00000359671	14c	ENSE00001342429	chr2:216274462-216274286	177	FINC_HUMAN	708-767	60	0	-	-
1.15b	ENST00000359671	15b	ENSE00001146152	chr2:216273149-216273021	129	FINC_HUMAN	767-810	44	0	-	-
1.16	ENST00000359671	16	ENSE00001342422	chr2:216272920-216272831	90	FINC_HUMAN	810-840	31	0	-	-
1.17	ENST00000359671	17	ENSE00001342419	chr2:216272044-216271850	195	FINC_HUMAN	840-905	66	0	-	-
1.18	ENST00000359671	18	ENSE00001342416	chr2:216271233-216270961	273	FINC_HUMAN	905-996	92	0	-	-
1.19	ENST00000359671	19	ENSE00001146122	chr2:216269378-216269112	267	FINC_HUMAN	996-1085	90	0	-	-
1.20	ENST00000359671	20	ENSE00001146112	chr2:216264074-216263980	95	FINC_HUMAN	1085-1116	32	0	-	-
1.21b	ENST00000359671	21b	ENSE00000965892	chr2:216262571-216262403	169	FINC_HUMAN	1117-1173	57	0	-	-
1.22	ENST00000359671	22	ENSE00001146105	chr2:216261946-216261860	87	FINC_HUMAN	1173-1202	30	0	-	-
1.23	ENST00000359671	23	ENSE00001342408	chr2:216259442-216259251	192	FINC_HUMAN	1202-1266	65	0	-	-
1.25c	ENST00000359671	25c	ENSE00001146412	chr2:216256537-216256355	183	FINC_HUMAN	1266-1327	62	0	-	-
1.26	ENST00000359671	26	ENSE00001342403	chr2:216253024-216252935	90	FINC_HUMAN	1327-1357	31	0	-	-
1.27a	ENST00000359671	27a	ENSE00001342401	chr2:216251681-216251412	270	FINC_HUMAN	1357-1447	91	0	-	-
1.28a	ENST00000359671	28a	ENSE00001342398	chr2:216249699-216249583	117	FINC_HUMAN	1447-1486	40	0	-	-
1.28c	ENST00000359671	28c	ENSE00001146062	chr2:216248907-216248743	165	FINC_HUMAN	1486-1541	56	0	-	-
1.29	ENST00000359671	29	ENSE00001342394	chr2:216248206-216248051	156	FINC_HUMAN	1541-1593	53	0	-	-
1.30a	ENST00000359671	30a	ENSE00001146049	chr2:216247048-216246935	114	FINC_HUMAN	1593-1631	39	0	-	-
1.30f	ENST00000359671	30f	ENSE00001245789	chr2:216245803-216245534	270	FINC_HUMAN	1631-1721	91	0	-	-
1.30h	ENST00000359671	30h	ENSE00001342389	chr2:216244040-216243853	188	FINC_HUMAN	1721-1783	63	0	-	-
1.31	ENST00000359671	31	ENSE00001342388	chr2:216242985-216242898	88	FINC_HUMAN	1784-1813	30	0	-	-
1.32	ENST00000359671	32	ENSE00001245772	chr2:216241397-216241221	177	FINC_HUMAN	1813-1872	60	0	-	-
1.33c	ENST00000359671	33c	ENSE00001342219	chr2:216240441-216240352	90	FINC_HUMAN	1872-1902	31	0	-	-
1.34	ENST00000359671	34	ENSE00001145995	chr2:216240116-216239937	180	FINC_HUMAN	1902-1962	61	0	-	-
1.35	ENST00000359671	35	ENSE00001145987	chr2:216238134-216238045	90	FINC_HUMAN	1962-1992	31	0	-	-
1.36d	ENST00000359671	36d	ENSE00001145978	chr2:216237098-216236632	467	FINC_HUMAN	1992-2147	156	0	-	-
1.37d	ENST00000359671	37d	ENSE00001342210	chr2:216235155-216235017	139	FINC_HUMAN	2148-2194	47	0	-	-
1.38a	ENST00000359671	38a	ENSE00001603320	chr2:216232750-216232586	165	FINC_HUMAN	2194-2249	56	0	-	-
1.39c	ENST00000359671	39c	ENSE00001598844	chr2:216230353-216230228	126	FINC_HUMAN	2249-2291	43	0	-	-
1.40a	ENST00000359671	40a	ENSE00001649647	chr2:216229708-216229602	107	FINC_HUMAN	2291-2326	36	0	-	-
1.41b	ENST00000359671	41b	ENSE00001740966	chr2:216226802-216226692	111	FINC_HUMAN	2327-2363	37	0	-	-
1.42f	ENST00000359671	42f	ENSE00001696465	chr2:216226349-216225181	1169	FINC_HUMAN	2364-2386	23	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:93
 aligned with FINC_HUMAN | P02751 from UniProtKB/Swiss-Prot  Length:2386

    Alignment length:93
                                   192       202       212       222       232       242       252       262       272   
           FINC_HUMAN   183 AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS 275
               SCOP domains d1fbra1 A:1-46 Fibronectin                    d1fbra2 A:47-93 Fibronectin                     SCOP domains
               CATH domains 1fbrA01 A:1-46 Complement Module, domain 1    1fbrA02 A:47-93 Complement Module, domain 1     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....eeee...eeeee.....eeeeee.......eeeee..eeee....eeee...eeeee.....eeeeee.......eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -FN1_2  PDB: A:2-46 UniProt: 184-228          FN1_2  PDB: A:47-91 UniProt: 229-273         -- PROSITE (1)
                PROSITE (2) ---FN1_1  PDB: A:4-43 UniProt: 186-225     -----FN1_1  PDB: A:49-88 UniProt: 231-270    ----- PROSITE (2)
           Transcript 1 (1) 1---------------------------------------------Exon 1.6  PDB: A:47-93 UniProt: 229-282         Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: A:1-47 UniProt: 183-229         ---------------------------------------------- Transcript 1 (2)
                 1fbr A   1 AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS  93
                                    10        20        30        40        50        60        70        80        90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: FnI-like domain (17)

Superfamily: FnI-like domain (17)

Family: Fibronectin type I module (15)

Protein domain: Fibronectin (12)

Human (Homo sapiens) [TaxId: 9606] (12)

1a	d1fbra1	A:1-46
1b	d1fbra2	A:47-93

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Ribbon (789)

Topology: Complement Module; domain 1 (62)

Homologous Superfamily: Complement Module, domain 1 (60)

Human (Homo sapiens) (46)

1a	1fbrA01	A:1-46
1b	1fbrA02	A:47-93

(no "Pfam Domain" information available for 1FBR)

NMR Structure(hide GO term definitions)

Chain A (FINC_HUMAN | P02751)

molecular function
	GO:0005518	collagen binding	Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0045340	mercury ion binding	Interacting selectively and non-covalently with mercury (Hg) ions.
	GO:0016504	peptidase activator activity	Binds to and increases the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006953	acute-phase response	An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0007161	calcium-independent cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules that do not require the presence of calcium for the interaction.
	GO:0001775	cell activation	A change in the morphology or behavior of a cell resulting from exposure to an activating factor such as a cellular or soluble ligand.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0007044	cell-substrate junction assembly	The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
	GO:0071773	cellular response to BMP stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
	GO:0071333	cellular response to glucose stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0071347	cellular response to interleukin-1	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0071288	cellular response to mercury ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mercury ion stimulus.
	GO:0036120	cellular response to platelet-derived growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platelet-derived growth factor stimulus.
	GO:0071380	cellular response to prostaglandin E stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin E stimulus.
	GO:0071560	cellular response to transforming growth factor beta stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
	GO:0035924	cellular response to vascular endothelial growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vascular endothelial growth factor stimulus.
	GO:0035987	endodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an endoderm cell, a cell of the inner of the three germ layers of the embryo.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0008347	glial cell migration	The orderly movement of a glial cell, non-neuronal cells that provide support and nutrition, maintain homeostasis, form myelin, and participate in signal transmission in the nervous system.
	GO:0033622	integrin activation	The aggregation, arrangement and bonding together of an integrin, a heterodimeric adhesion receptor formed by the non-covalent association of particular alpha and beta subunits, that lead to the increased affinity of the integrin for its extracellular ligands.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:2001202	negative regulation of transforming growth factor-beta secretion	Any process that stops, prevents or reduces the frequency, rate or extent of transforming growth factor-beta secretion.
	GO:0018149	peptide cross-linking	The formation of a covalent cross-link between or within protein chains.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0045773	positive regulation of axon extension	Any process that activates or increases the frequency, rate or extent of axon extension.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0050921	positive regulation of chemotaxis	Any process that activates or increases the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
	GO:0048146	positive regulation of fibroblast proliferation	Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0010952	positive regulation of peptidase activity	Any process that increases the frequency, rate or extent of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:1904237	positive regulation of substrate-dependent cell migration, cell attachment to substrate	Any process that activates or increases the frequency, rate or extent of substrate-dependent cell migration, cell attachment to substrate.
	GO:0070372	regulation of ERK1 and ERK2 cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0001932	regulation of protein phosphorylation	Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0002931	response to ischemia	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a inadequate blood supply.
	GO:0010193	response to ozone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ozone stimulus.
	GO:0009611	response to wounding	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
	GO:0034446	substrate adhesion-dependent cell spreading	The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0005605	basal lamina	A thin sheet of proteoglycans and glycoproteins, especially laminin, secreted by cells as an extracellular matrix.
	GO:0005604	basement membrane	A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	A complex system of membrane-bounded compartments located between endoplasmic reticulum (ER) and the Golgi complex, with a distinctive membrane protein composition; involved in ER-to-Golgi and Golgi-to-ER transport.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005577	fibrinogen complex	A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fbr)

	Sites
(no "Sites" information available for 1fbr)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fbr)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1fbr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FINC_HUMAN \| P02751
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FINC_HUMAN \| P02751
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1FBR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (63, 63)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File