1F1J - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CASPASE-7 IN COMPLEX WITH ACETYL-ASP-GLU-VAL-ASP-CHO

Authors :   Y. Wei, P. S. Charifson

Date :   19 May 00 (Deposition) - 23 May 01 (Release) - 03 Jul 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.35

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)
Biol. Unit 3: A,B,C,D  (2x)
Biol. Unit 4: A,B,C,D  (1x)
Biol. Unit 5: A (1x),B (1x),C (1x),D (1x)

Keywords :   Caspase-7, Cysteine Protease, Hydrolase, Apoptosis, Hydrolase- Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Wei, T. Fox, S. P. Chambers, J. Sintchak, J. T. Coll, J. M. Golec, L. Swenson, K. P. Wilson, P. S. Charifson
The Structures Of Caspases-1, -3, -7 And -8 Reveal The Basi For Substrate And Inhibitor Selectivity.
Chem. Biol. V. 7 423 2000
PubMed-ID: 10873833 | Reference-DOI: 10.1016/S1074-5521(00)00123-X

Molecule 1 - CASPASE-7 PROTEASE
	Chains	:	A, B
	EC Number	:	3.4.22.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	P20/P10 CATALYTIC DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - ACE-ASP-GLU-VAL-ASP-CHO
	Chains	:	C, D
	Engineered	:	YES
	Other Details	:	THIS SEQUENCE WAS CHEMICALLY SYNTHESIZED
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D
Biological Unit 3 (2x)	:	A	B	C	D
Biological Unit 4 (1x)	:	A	B	C	D
Biological Unit 5 (1x)	:	A (1x)	B (1x)	C (1x)	D (1x)

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 6)

No.	Name	Count	Type	Full Name
1	ACE	2	Mod. Amino Acid	ACETYL GROUP
2	ASJ	2	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 1 (3, 3)

No.	Name	Count	Type	Full Name
1	ACE	1	Mod. Amino Acid	ACETYL GROUP
2	ASJ	1	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (3, 3)

No.	Name	Count	Type	Full Name
1	ACE	1	Mod. Amino Acid	ACETYL GROUP
2	ASJ	1	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 3 (3, 12)

No.	Name	Count	Type	Full Name
1	ACE	4	Mod. Amino Acid	ACETYL GROUP
2	ASJ	4	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 4 (3, 6)

No.	Name	Count	Type	Full Name
1	ACE	2	Mod. Amino Acid	ACETYL GROUP
2	ASJ	2	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 5 (3, 3)

No.	Name	Count	Type	Full Name
1	ACE	1	Mod. Amino Acid	ACETYL GROUP
2	ASJ	1	Mod. Amino Acid	(3S)-3-AMINO-4-HYDROXYBUTANOIC ACID
3	SO4	1	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:76 , ASN A:88 , GLY A:89 , THR A:90 , ASP A:91 , LYS A:92 , HOH A:1136	BINDING SITE FOR RESIDUE SO4 A 1201
2	AC2	SOFTWARE	LYS B:376 , GLY B:389 , THR B:390 , ASP B:391 , LYS B:392 , LYS B:399 , HOH B:775	BINDING SITE FOR RESIDUE SO4 B 1202
3	AC3	SOFTWARE	ARG A:87 , ASN A:88 , SER A:143 , HIS A:144 , GLY A:145 , GLN A:184 , CYS A:186 , TYR A:230 , SER A:231 , TRP A:232 , ARG A:233 , SER A:234 , PRO A:235 , SER A:275 , GLN A:276 , HOH C:921 , HOH C:1130	BINDING SITE FOR CHAIN C OF ACE-ASP-GLU-VAL-ASP- CHO
4	AC4	SOFTWARE	ARG B:387 , HIS B:444 , GLY B:445 , GLN B:484 , CYS B:486 , SER B:531 , TRP B:532 , ARG B:533 , SER B:534 , PRO B:535 , SER B:575 , GLN B:576 , HOH B:920 , HOH D:807 , HOH D:808 , HOH D:809	BINDING SITE FOR CHAIN D OF ACE-ASP-GLU-VAL-ASP- CHO

(no "SS Bond" information available for 1F1J)

(no "Cis Peptide Bond" information available for 1F1J)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A B	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A A	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A B	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A A/B	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A A/B	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048618	D	255	E	CASP7_HUMAN	Polymorphism	2227310	A A/B	D	255 555	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	2	A:66-190 B:366-490
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	2	A:131-145 B:431-445
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	2	A:177-188 B:477-488
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	2	A:212-302 B:512-602

Biological Unit 1 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	1	A:66-190 -
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	1	A:131-145 -
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	1	A:177-188 -
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	1	A:212-302 -

Biological Unit 2 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	1	- B:366-490
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	1	- B:431-445
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	1	- B:477-488
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	1	- B:512-602

Biological Unit 3 (4, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	4	A:66-190 B:366-490
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	4	A:131-145 B:431-445
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	4	A:177-188 B:477-488
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	4	A:212-302 B:512-602

Biological Unit 4 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	2	A:66-190 B:366-490
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	2	A:131-145 B:431-445
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	2	A:177-188 B:477-488
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	2	A:212-302 B:512-602

Biological Unit 5 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP7_HUMAN	66-190	2	A:66-190 B:366-490
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP7_HUMAN	131-145	2	A:131-145 B:431-445
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP7_HUMAN	177-188	2	A:177-188 B:477-488
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP7_HUMAN	209-303	2	A:212-302 B:512-602

Asymmetric Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2c	ENST00000369318	2c	ENSE00001832746	chr10:115439636-115439737	102	CASP7_HUMAN	-	0	0	-	-
1.4b	ENST00000369318	4b	ENSE00001749353	chr10:115457253-115457362	110	CASP7_HUMAN	1-37	37	0	-	-
1.6b	ENST00000369318	6b	ENSE00001096780	chr10:115480791-115480927	137	CASP7_HUMAN	37-83	47	2	A:58-83 B:357-383	26 27
1.7d	ENST00000369318	7d	ENSE00001096775	chr10:115481410-115481538	129	CASP7_HUMAN	83-126	44	2	A:83-126 B:383-426	44 44
1.8c	ENST00000369318	8c	ENSE00001096779	chr10:115485121-115485296	176	CASP7_HUMAN	126-184	59	2	A:126-184 B:426-484	59 59
1.10b	ENST00000369318	10b	ENSE00001656181	chr10:115486064-115486193	130	CASP7_HUMAN	185-228	44	2	A:185-228 (gaps) B:485-528 (gaps)	44 44
1.11c	ENST00000369318	11c	ENSE00001591443	chr10:115489070-115490662	1593	CASP7_HUMAN	228-303	76	2	A:228-302 B:528-602	75 75

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:230
 aligned with CASP7_HUMAN | P55210 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:245
                                    67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297     
          CASP7_HUMAN    58 YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 302
               SCOP domains d1f1ja_ A: Caspase-7                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1f1jA00 A:58-302  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeee..............hhhhhhhhhhhhhhhhheeeeeee..hhhhhhhhhhhhhhhhhh.eeeeeeeee..ee..eee....eeehhhhhhh.....hhhhh...eeeeee............---------------.......eeeee........eee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.....hhhhh......eeee......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------CASPASE_P20  PDB: A:66-190 UniProt: 66-190                                                                                   ------------------CASPASE_P10  PDB: A:212-302 UniProt: 209-303                                                   PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.6b  PDB: A:58-83   ------------------------------------------Exon 1.8c  PDB: A:126-184 UniProt: 126-184                 Exon 1.10b  PDB: A:185-228 (gaps)           -------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.7d  PDB: A:83-126 UniProt: 83-126    -----------------------------------------------------------------------------------------------------Exon 1.11c  PDB: A:228-302 UniProt: 228-303 [INCOMPLETE]                    Transcript 1 (2)
                 1f1j A  58 YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRSKTLLEKPKLFFIQACRGTELDDGIQ---------------KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 302
                                    67        77        87        97       107       117       127       137       147       157       167       177       187        |-         -    |  217       227       237       247       257       267       277       287       297     
                                                                                                                                                                    196             212

Chain B from PDB  Type:PROTEIN  Length:231
 aligned with CASP7_HUMAN | P55210 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:246
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296      
          CASP7_HUMAN    57 TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 302
               SCOP domains d1f1jb_ B: Caspase-7                                                                                                                                                                                                                                   SCOP domains
               CATH domains 1f1jB00 B:357-602  [code=3.40.50.1460, no name defined]                                                                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeeeeee....hhhhh.....hhhhhhhhhhhhhhhhheeeeeee..hhhhhhhhhhhhhhh....eeeeeeeee..ee..eee....eeehhhhhhhhh...hhhhh...eeeeee...eee......---------------.......eeeee....ee..eee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.....hhhhh......eeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E----------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------CASPASE_P20  PDB: B:366-490 UniProt: 66-190                                                                                  ------------------CASPASE_P10  PDB: B:512-602 UniProt: 209-303                                                   PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.6b  PDB: B:357-383  ------------------------------------------Exon 1.8c  PDB: B:426-484 UniProt: 126-184                 Exon 1.10b  PDB: B:485-528 (gaps)           -------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.7d  PDB: B:383-426 UniProt: 83-126   -----------------------------------------------------------------------------------------------------Exon 1.11c  PDB: B:528-602 UniProt: 228-303 [INCOMPLETE]                    Transcript 1 (2)
                 1f1j B 357 TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRSKTLLEKPKLFFIQACRGTELDDGIQ---------------KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 602
                                   366       376       386       396       406       416       426       436       446       456       466       476       486       496         -     | 516       526       536       546       556       566       576       586       596      
                                                                                                                                                                     496             512

Chain C from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..ee. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 1f1j C 701 xDEVx 705
                            |   |
                          701-ACE
                              705-ASJ

Chain D from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..ee. Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 1f1j D 801 xDEVx 805
                            |   |
                            |   |
                          801-ACE
                              805-ASJ

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Caspase-like (92)

Superfamily: Caspase-like (92)

Family: Caspase catalytic domain (76)

Protein domain: Caspase-7 (12)

Human (Homo sapiens) [TaxId: 9606] (12)

1a	d1f1ja_	A:
1b	d1f1jb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.1460, no name defined] (93)

Human (Homo sapiens) (87)

1a	1f1jA00	A:58-302
1b	1f1jB00	B:357-602

(no "Pfam Domain" information available for 1F1J)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CASP7_HUMAN | P55210)

molecular function
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile, and contributing to the execution phase of apoptosis.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process and is mediated by cytochrome c.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006921	cellular component disassembly involved in execution phase of apoptosis	The breakdown of structures such as organelles, proteins, or other macromolecular structures during apoptosis.
	GO:0097194	execution phase of apoptosis	A stage of the apoptotic process that starts with the controlled breakdown of the cell through the action of effector caspases or other effector molecules (e.g. cathepsins, calpains etc.). Key steps of the execution phase are rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ASJ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1f1j)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1f1j
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CASP7_HUMAN \| P55210
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.22.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CASP7_HUMAN \| P55210
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1F1J)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (4, 8)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File