1EY3 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF ENOYL-COA HYDRATASE COMPLEXED WITH THE SUBSTRATE DAC-COA

Authors :   B. J. Bahnson, V. E. Anderson, G. A. Petsko

Date :   05 May 00 (Deposition) - 27 Feb 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Beta-Oxidation, Crotonase, Enoyl-Coa Hydratase, Fatty Acid Metabolism, Beta-Elimination, Syn-Addition, Concerted Reaction, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. J. Bahnson, V. E. Anderson, G. A. Petsko
Structural Mechanism Of Enoyl-Coa Hydratase: Three Atoms From A Single Water Are Added In Either An E1Cb Stepwise Or Concerted Fashion.
Biochemistry V. 41 2621 2002
PubMed-ID: 11851409 | Reference-DOI: 10.1021/BI015844P
(for further references see the PDB file header)

Molecule 1 - ENOYL-COA HYDRATASE
	Chains	:	A, B, C, D, E, F
	EC Number	:	4.2.1.17
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET20B(+)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organ	:	LIVER
	Organelle	:	MITOCHONDRIA
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	CROTONASE

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 6)

No.	Name	Count	Type	Full Name
1	DAK	6	Ligand/Ion	4-(N,N-DIMETHYLAMINO)CINNAMOYL-COA

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:56 , ALA A:57 , LEU A:58 , ALA A:60 , ALA A:96 , GLY A:97 , ALA A:98 , ASP A:99 , ILE A:100 , LEU A:117 , TRP A:120 , TYR A:137 , GLY A:141 , PRO A:163 , LEU A:167 , GLY A:172 , ARG A:197 , HOH A:501 , HOH A:542 , HOH A:545 , HOH A:565 , PHE B:263 , LYS B:282	BINDING SITE FOR RESIDUE DAK A 500
2	AC2	SOFTWARE	LYS B:56 , ALA B:57 , LEU B:58 , ALA B:96 , GLY B:97 , ALA B:98 , ASP B:99 , ILE B:100 , LYS B:101 , LEU B:117 , TRP B:120 , GLY B:141 , PRO B:163 , LEU B:167 , GLY B:172 , HOH B:518 , HOH B:554 , HOH B:563 , PHE C:263 , PHE C:279 , LYS C:282	BINDING SITE FOR RESIDUE DAK B 501
3	AC3	SOFTWARE	PHE A:263 , LYS C:56 , ALA C:57 , LEU C:58 , ALA C:60 , ALA C:96 , GLY C:97 , ALA C:98 , ASP C:99 , ILE C:100 , LEU C:117 , TRP C:120 , LEU C:139 , GLY C:141 , PRO C:163 , LEU C:167 , GLY C:172	BINDING SITE FOR RESIDUE DAK C 502
4	AC4	SOFTWARE	LYS D:56 , ALA D:57 , LEU D:58 , ALA D:60 , LYS D:92 , ALA D:96 , GLY D:97 , ALA D:98 , ASP D:99 , ILE D:100 , LYS D:101 , LEU D:117 , TRP D:120 , GLY D:141 , PRO D:163 , LEU D:167 , GLY D:172 , HOH D:524 , HOH D:571 , LYS E:260 , PHE E:263 , LYS E:282	BINDING SITE FOR RESIDUE DAK D 503
5	AC5	SOFTWARE	LYS E:56 , ALA E:57 , LEU E:58 , ALA E:60 , ALA E:96 , GLY E:97 , ALA E:98 , ASP E:99 , ILE E:100 , LYS E:101 , LEU E:117 , TRP E:120 , GLY E:141 , PRO E:163 , LEU E:167 , GLY E:172 , HOH E:525 , HOH E:541 , PHE F:263 , LYS F:282	BINDING SITE FOR RESIDUE DAK E 504
6	AC6	SOFTWARE	PHE D:263 , LYS F:56 , ALA F:57 , LEU F:58 , ALA F:60 , ALA F:96 , GLY F:97 , ALA F:98 , ASP F:99 , ILE F:100 , LEU F:117 , TRP F:120 , GLY F:141 , PRO F:163 , LEU F:167 , GLY F:172 , ARG F:197 , HOH F:528 , HOH F:553	BINDING SITE FOR RESIDUE DAK F 505

(no "SS Bond" information available for 1EY3)

(no "Cis Peptide Bond" information available for 1EY3)

(no "SAP(SNP)/Variant" information available for 1EY3)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ENOYL_COA_HYDRATASE	PS00166	Enoyl-CoA hydratase/isomerase signature.	ECHM_RAT	131-151	6	A:131-151 B:131-151 C:131-151 D:131-151 E:131-151 F:131-151

Asymmetric/Biological Unit (7, 42)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000025446	1	ENSRNOE00000179019	chr1:199910412-199910308	105	ECHM_RAT	1-30	30	0	-	-
1.2	ENSRNOT00000025446	2	ENSRNOE00000180786	chr1:199908251-199908054	198	ECHM_RAT	30-96	67	6	A:33-96 B:33-96 C:33-96 D:33-96 E:33-96 F:33-96	64 64 64 64 64 64
1.3	ENSRNOT00000025446	3	ENSRNOE00000180948	chr1:199907664-199907537	128	ECHM_RAT	96-138	43	6	A:96-138 B:96-138 C:96-138 D:96-138 E:96-138 F:96-138	43 43 43 43 43 43
1.4	ENSRNOT00000025446	4	ENSRNOE00000181097	chr1:199906925-199906826	100	ECHM_RAT	139-172	34	6	A:139-172 B:139-172 C:139-172 D:139-172 E:139-172 F:139-172	34 34 34 34 34 34
1.5	ENSRNOT00000025446	5	ENSRNOE00000181259	chr1:199905995-199905891	105	ECHM_RAT	172-207	36	6	A:172-207 B:172-207 C:172-207 D:172-207 E:172-207 F:172-207	36 36 36 36 36 36
1.6	ENSRNOT00000025446	6	ENSRNOE00000179510	chr1:199905454-199905335	120	ECHM_RAT	207-247	41	6	A:207-247 B:207-247 C:207-247 D:207-247 E:207-247 F:207-247	41 41 41 41 41 41
1.7	ENSRNOT00000025446	7	ENSRNOE00000181392	chr1:199903551-199903484	68	ECHM_RAT	247-269	23	6	A:247-269 B:247-269 C:247-269 D:247-269 E:247-269 F:247-269	23 23 23 23 23 23
1.8	ENSRNOT00000025446	8	ENSRNOE00000181536	chr1:199902222-199901588	635	ECHM_RAT	270-290	21	6	A:270-290 B:270-290 C:270-290 D:270-290 E:270-290 F:270-290	21 21 21 21 21 21

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3a_ A: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3A01 A:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3A02 A:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee......eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhh........hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: A:139-172          ----------------------------------Exon 1.6  PDB: A:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: A:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: A:172-207            ---------------------------------------Exon 1.7  PDB: A:247-26--------------------- Transcript 1 (2)
                 1ey3 A  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Chain B from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3b_ B: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3B01 B:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3B02 B:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee.......eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhh........hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: B:139-172          ----------------------------------Exon 1.6  PDB: B:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: B:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: B:172-207            ---------------------------------------Exon 1.7  PDB: B:247-26--------------------- Transcript 1 (2)
                 1ey3 B  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Chain C from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3c_ C: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3C01 C:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3C02 C:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee......eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhhh.......hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: C:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: C:139-172          ----------------------------------Exon 1.6  PDB: C:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: C:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: C:172-207            ---------------------------------------Exon 1.7  PDB: C:247-26--------------------- Transcript 1 (2)
                 1ey3 C  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Chain D from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3d_ D: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3D01 D:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3D02 D:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee......eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhh........hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: D:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: D:139-172          ----------------------------------Exon 1.6  PDB: D:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: D:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: D:172-207            ---------------------------------------Exon 1.7  PDB: D:247-26--------------------- Transcript 1 (2)
                 1ey3 D  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Chain E from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3e_ E: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3E01 E:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3E02 E:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee.....eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhh........hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: E:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: E:139-172          ----------------------------------Exon 1.6  PDB: E:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: E:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: E:172-207            ---------------------------------------Exon 1.7  PDB: E:247-26--------------------- Transcript 1 (2)
                 1ey3 E  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Chain F from PDB  Type:PROTEIN  Length:258
 aligned with ECHM_RAT | P14604 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:258
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
             ECHM_RAT    33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
               SCOP domains d1ey3f_ F: Enoyl-CoA hydratase (crotonase)                                                                                                                                                                                                                         SCOP domains
               CATH domains 1ey3F01 F:33-232 2-enoyl-CoA Hydratase; Chain A, domain 1                                                                                                                                               1ey3F02 F:233-290                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee.....eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeee....eee...hhhhhh..hhhhhh........hhhhhh...eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh........hhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------ENOYL_COA_HYDRATASE  ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: F:33-96 UniProt: 30-96 [INCOMPLETE]              ------------------------------------------Exon 1.4  PDB: F:139-172          ----------------------------------Exon 1.6  PDB: F:207-247 UniProt: 207-247----------------------Exon 1.8              Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: F:96-138 UniProt: 96-138    ---------------------------------Exon 1.5  PDB: F:172-207            ---------------------------------------Exon 1.7  PDB: F:247-26--------------------- Transcript 1 (2)
                 1ey3 F  33 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH 290
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: ClpP/crotonase (207)

Superfamily: ClpP/crotonase (207)

Family: Crotonase-like (39)

Protein domain: Enoyl-CoA hydratase (crotonase) (5)

Norway rat (Rattus norvegicus) [TaxId: 10116] (4)

1a	d1ey3a_	A:
1b	d1ey3e_	E:
1c	d1ey3f_	F:
1d	d1ey3b_	B:
1e	d1ey3c_	C:
1f	d1ey3d_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: 2-enoyl-CoA Hydratase; Chain A, domain 1 (89)

Homologous Superfamily: 2-enoyl-CoA Hydratase; Chain A, domain 1 (89)

Norway rat (Rattus norvegicus) (6)

1a	1ey3A01	A:33-232
1b	1ey3B01	B:33-232
1c	1ey3C01	C:33-232
1d	1ey3D01	D:33-232
1e	1ey3E01	E:33-232
1f	1ey3F01	F:33-232

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 (25)

Homologous Superfamily: Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 (25)

Norway rat (Rattus norvegicus) (5)

2a	1ey3A02	A:233-290
2b	1ey3E02	E:233-290
2c	1ey3F02	F:233-290
2d	1ey3B02	B:233-290
2e	1ey3C02	C:233-290
2f	1ey3D02	D:233-290

(no "Pfam Domain" information available for 1EY3)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E,F (ECHM_RAT | P14604)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004300	enoyl-CoA hydratase activity	Catalysis of the reaction: (3S)-3-hydroxyacyl-CoA = trans-2-enoyl-CoA + H2O.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
	GO:0006635	fatty acid beta-oxidation	A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DAK	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ey3)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ey3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ECHM_RAT \| P14604
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.2.1.17
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ECHM_RAT \| P14604
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ECHM_RAT \| P14604	:	1dub 1mj3 2dub

(no "Related Entries Specified in the PDB File" available for 1EY3)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (7, 42)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (2, 12)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File