|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 8)
|
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 1ELW) |
(no "Cis Peptide Bond" information available for 1ELW) |
(no "SAP(SNP)/Variant" information available for 1ELW) |
Asymmetric Unit (2, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:117 aligned with STIP1_HUMAN | P31948 from UniProtKB/Swiss-Prot Length:543 Alignment length:117 11 21 31 41 51 61 71 81 91 101 111 STIP1_HUMAN 2 EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR 118 SCOP domains d1elwa_ A: Hop SCOP domains CATH domains 1elwA00 A:2-118 [code=1.25.40.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --TPR PDB: A:4-37 UniProt: 4-37 TPR PDB: A:38-71 UniProt: 38-71 TPR PDB: A:72-105 UniProt: 72-105------------- PROSITE (1) PROSITE (2) --TPR_REGION PDB: A:4-105 UniProt: 4-105 ------------- PROSITE (2) Transcript 1 1.Exon 1.3 PDB: A:4-73 UniProt: 4-73 Exon 1.4 PDB: A:74-118 UniProt: 74-121 Transcript 1 1elw A 2 EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR 118 11 21 31 41 51 61 71 81 91 101 111 Chain B from PDB Type:PROTEIN Length:115 aligned with STIP1_HUMAN | P31948 from UniProtKB/Swiss-Prot Length:543 Alignment length:115 10 20 30 40 50 60 70 80 90 100 110 STIP1_HUMAN 1 MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNM 115 SCOP domains d1elwb_ B: Hop SCOP domains CATH domains 1elwB00 B:1-115 [code=1.25.40.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---TPR PDB: B:4-37 UniProt: 4-37 TPR PDB: B:38-71 UniProt: 38-71 TPR PDB: B:72-105 UniProt: 72-105---------- PROSITE (1) PROSITE (2) ---TPR_REGION PDB: B:4-105 UniProt: 4-105 ---------- PROSITE (2) Transcript 1 1.2Exon 1.3 PDB: B:4-73 UniProt: 4-73 Exon 1.4 PDB: B:74-115 UniProt: 74-121 Transcript 1 1elw B 1 MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNM 115 10 20 30 40 50 60 70 80 90 100 110 Chain C from PDB Type:PROTEIN Length:8 SCOP domains -------- SCOP domains CATH domains -------- CATH domains Pfam domains -------- Pfam domains SAPs(SNPs) -------- SAPs(SNPs) PROSITE -------- PROSITE Transcript -------- Transcript 1elw C 5 GPTIEEVD 12 Chain D from PDB Type:PROTEIN Length:8 SCOP domains -------- SCOP domains CATH domains -------- CATH domains Pfam domains -------- Pfam domains SAPs(SNPs) -------- SAPs(SNPs) PROSITE -------- PROSITE Transcript -------- Transcript 1elw D 5 GPTIEEVD 12
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1ELW) |
Asymmetric Unit(hide GO term definitions) Chain A,B (STIP1_HUMAN | P31948)
|
|
|
|
|
|
|