|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DXG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DXG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DXG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1DXG) |
Exons (0, 0)| (no "Exon" information available for 1DXG) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:36 aligned with DESR_DESGI | P00273 from UniProtKB/Swiss-Prot Length:37 Alignment length:36 11 21 31 DESR_DESGI 2 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 37 SCOP domains d1dxga_ A: Desulforedoxin SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1dxg A 1 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 36 10 20 30 Chain B from PDB Type:PROTEIN Length:36 aligned with DESR_DESGI | P00273 from UniProtKB/Swiss-Prot Length:37 Alignment length:36 11 21 31 DESR_DESGI 2 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 37 SCOP domains d1dxgb_ B: Desulforedoxin SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1dxg B 1 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 36 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1DXG) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DXG) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (DESR_DESGI | P00273)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|