|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1CFW) |
(no "Cis Peptide Bond" information available for 1CFW) |
(no "SAP(SNP)/Variant" information available for 1CFW) |
(no "PROSITE Motif" information available for 1CFW) |
(no "Exon" information available for 1CFW) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:36 aligned with DESR_DESGI | P00273 from UniProtKB/Swiss-Prot Length:37 Alignment length:36 11 21 31 DESR_DESGI 2 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 37 SCOP domains d1cfwa_ A: Desulforedoxin SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1cfw A 1 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 36 10 20 30 Chain B from PDB Type:PROTEIN Length:36 aligned with DESR_DESGI | P00273 from UniProtKB/Swiss-Prot Length:37 Alignment length:36 11 21 31 DESR_DESGI 2 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 37 SCOP domains d1cfwb_ B: Desulforedoxin SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------ SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript ------------------------------------ Transcript 1cfw B 1 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ 36 10 20 30
|
Asymmetric/Biological Unit
|
(no "CATH Domain" information available for 1CFW) |
(no "Pfam Domain" information available for 1CFW) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (DESR_DESGI | P00273)
|
|
|
|
|
|
|