|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1CMC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1CMC) |
SAPs(SNPs)/Variants (2, 4)
Asymmetric/Biological Unit (2, 4)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1CMC) |
Exons (0, 0)| (no "Exon" information available for 1CMC) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:104 aligned with METJ_ECOLI | P0A8U6 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 METJ_ECOLI 2 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 105 SCOP domains d1cmca_ A: Met repressor, MetJ (MetR) SCOP domains CATH domains 1cmcA00 A:1-104 MET Apo-Repressor, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------Q---T-------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1cmc A 1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 104 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:104 aligned with METJ_ECOLI | P0A8U6 from UniProtKB/Swiss-Prot Length:105 Alignment length:104 11 21 31 41 51 61 71 81 91 101 METJ_ECOLI 2 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 105 SCOP domains d1cmcb_ B: Met repressor, MetJ (MetR) SCOP domains CATH domains 1cmcB00 B:1-104 MET Apo-Repressor, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------Q---T-------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1cmc B 1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 104 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1CMC) |
Gene Ontology (10, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (METJ_ECOLI | P0A8U6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|