1CMA | PDR008 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   MET REPRESSOR/DNA COMPLEX + S-ADENOSYL-METHIONINE

Authors :   W. S. Somers, S. E. V. Phillips

Date :   24 Aug 92 (Deposition) - 31 Oct 93 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (2x)

Keywords :   Protein-Dna Complex, Double Helix, Transcription/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. S. Somers, S. E. Phillips
Crystal Structure Of The Met Repressor-Operator Complex At 2. 8 A Resolution Reveals Dna Recognition By Beta-Strands.
Nature V. 359 387 1992
PubMed-ID: 1406951 | Reference-DOI: 10.1038/359387A0
(for further references see the PDB file header)

*Molecule 1 - DNA (5'-D(TPTPAPGPAPCPGPTPCPT)-3')*
	Chains	:	C
	Engineered	:	YES
	Synthetic	:	YES

*Molecule 2 - DNA (5'-D(APGPAPCPGPTPCPTPA)-3')**
	Chains	:	D
	Engineered	:	YES
	Synthetic	:	YES

Molecule 3 - PROTEIN (MET REPRESSOR)
	Chains	:	A, B
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (2x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	SAM	2	Ligand/Ion	S-ADENOSYLMETHIONINE

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	SAM	4	Ligand/Ion	S-ADENOSYLMETHIONINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:64 , PHE A:65 , GLU B:39 , ARG B:42 , ARG B:43 , LEU B:56 , GLU B:59 , HIS B:63 , PRO B:71 , ARG B:77	BINDING SITE FOR RESIDUE SAM A 105
2	AC2	SOFTWARE	GLU A:39 , ARG A:42 , ARG A:43 , LEU A:56 , GLU A:59 , HIS A:63 , PRO A:71 , HOH A:107 , PHE B:61 , HIS B:63 , ALA B:64 , PHE B:65	BINDING SITE FOR RESIDUE SAM B 105

(no "SS Bond" information available for 1CMA)

(no "Cis Peptide Bond" information available for 1CMA)

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_METJ_ECOLI_001 *	L	57	Q	METJ_ECOLI	---	---	A/B	L	56	Q
2	UniProt	VAR_METJ_ECOLI_002 *	A	61	T	METJ_ECOLI	---	---	A/B	A	60	T
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_METJ_ECOLI_001 *	L	57	Q	METJ_ECOLI	---	---	A/B	L	56	Q
2	UniProt	VAR_METJ_ECOLI_002 *	A	61	T	METJ_ECOLI	---	---	A/B	A	60	T
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1CMA)

(no "Exon" information available for 1CMA)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:104
 aligned with METJ_ECOLI | P0A8U6 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
           METJ_ECOLI     2 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 105
               SCOP domains d1cmaa_ A: Met repressor, MetJ (MetR)                                                                    SCOP domains
               CATH domains 1cmaA00 A:1-104 MET Apo-Repressor, subunit A                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh...................hhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------Q---T-------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1cma A   1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 104
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:104
 aligned with METJ_ECOLI | P0A8U6 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
           METJ_ECOLI     2 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 105
               SCOP domains d1cmab_ B: Met repressor, MetJ (MetR)                                                                    SCOP domains
               CATH domains 1cmaB00 B:1-104 MET Apo-Repressor, subunit A                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................eeeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh...................hhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------Q---T-------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1cma B   1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY 104
                                    10        20        30        40        50        60        70        80        90       100

Chain C from PDB  Type:DNA  Length:10
                                          
                 1cma C   1 TTAGACGTCT  10
                                    10

Chain D from PDB  Type:DNA  Length:9
                                         
                 1cma D  11 AGACGTCTA  19

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Ribbon-helix-helix (65)

Superfamily: Ribbon-helix-helix (65)

Family: Met repressor, MetJ (MetR) (10)

Protein domain: Met repressor, MetJ (MetR) (10)

Escherichia coli [TaxId: 562] (10)

1a	d1cmaa_	A:
1b	d1cmab_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: MET Apo-Repressor, subunit A (10)

Homologous Superfamily: MET Apo-Repressor, subunit A (10)

[unclassified] (6)

1a	1cmaA00	A:1-104
1b	1cmaB00	B:1-104

(no "Pfam Domain" information available for 1CMA)

Asymmetric Unit(hide GO term definitions)

Chain A,B (METJ_ECOLI | P0A8U6)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0008652	cellular amino acid biosynthetic process	The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
	GO:0009086	methionine biosynthetic process	The chemical reactions and pathways resulting in the formation of methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
	GO:0006555	methionine metabolic process	The chemical reactions and pathways involving methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SAM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cma)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Midas
	proetin: ribbon, secondary structure; DNA: ribbon, plates; ligands: surface [ mono GIF format \| stereo GIF format ]
Setor
	protein: ribbon; DNA: ribbon, sticks; ligands: spacefill; chain-specific coloring [ mono GIF format \| stereo GIF format ]
	protein: ribbon; DNA: ribbon, sticks; ligands: spacefill; chain-specific coloring; otherview [ mono GIF format \| stereo GIF format ]
	protein, ligands: sticks; DNA: spacefill [ mono GIF format \| stereo GIF format ]
	protein, ligands: spacefill; DNA: sticks [ mono GIF format \| stereo GIF format ]
Distance Plot
	representative atoms: CA, O3' [ mono GIF format \| mono PDF format ]

Access by PDB/NDB ID
	1cma
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	METJ_ECOLI \| P0A8U6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	METJ_ECOLI \| P0A8U6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	METJ_ECOLI \| P0A8U6	:	1cmb 1cmc 1mj2 1mjk 1mjl 1mjm 1mjo 1mjp 1mjq

(no "Related Entries Specified in the PDB File" available for 1CMA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File