2A5E - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION NMR STRUCTURE OF TUMOR SUPPRESSOR P16INK4A, RESTRAINED MINIMIZED MEAN STRUCTURE

Authors :   I. -J. L. Byeon, J. Li, K. Ericson, T. L. Selby, A. Tevelev, H. -J. Kim, P. O'Maille, M. -D. Tsai

Date :   13 Feb 98 (Deposition) - 13 Aug 99 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Anti-Oncogene, Tumor-Suppressor-P16Ink4A (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. J. Byeon, J. Li, K. Ericson, T. L. Selby, A. Tevelev, H. J. Kim, P. O'Maille, M. D. Tsai
Tumor Suppressor P16Ink4A: Determination Of Solution Structure And Analyses Of Its Interaction With Cyclin-Dependent Kinase 4.
Mol. Cell V. 1 421 1998
PubMed-ID: 9660926 | Reference-DOI: 10.1016/S1097-2765(00)80042-8
(for further references see the PDB file header)

Molecule 1 - TUMOR SUPPRESSOR P16INK4A
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606


NMR Structure	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2A5E)

(no "Site" information available for 2A5E)

(no "SS Bond" information available for 2A5E)

(no "Cis Peptide Bond" information available for 2A5E)

NMR Structure (96, 96)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_001408	D	14	E	CDN2A_HUMAN	Unclassified	---	A	D	14	E
02	UniProt	VAR_001409	L	16	P	CDN2A_HUMAN	Unclassified	---	A	L	16	P
03	UniProt	VAR_001410	A	20	P	CDN2A_HUMAN	Unclassified	---	A	A	20	P
04	UniProt	VAR_001411	A	20	S	CDN2A_HUMAN	Unclassified	760065045	A	A	20	S
05	UniProt	VAR_001412	G	23	D	CDN2A_HUMAN	Unclassified	---	A	G	23	D
06	UniProt	VAR_001413	R	24	C	CDN2A_HUMAN	Disease (CMM2)	---	A	R	24	C
07	UniProt	VAR_001414	R	24	P	CDN2A_HUMAN	Disease (CMM2)	104894097	A	R	24	P
08	UniProt	VAR_058550	R	24	Q	CDN2A_HUMAN	Polymorphism	104894097	A	R	24	Q
09	UniProt	VAR_001415	E	26	D	CDN2A_HUMAN	Unclassified	---	A	E	26	D
10	UniProt	VAR_001416	L	32	P	CDN2A_HUMAN	Disease (CMM2)	878853650	A	L	32	P
11	UniProt	VAR_001417	E	33	D	CDN2A_HUMAN	Unclassified	---	A	E	33	D
12	UniProt	VAR_001418	G	35	A	CDN2A_HUMAN	Disease (CMM2)	746834149	A	G	35	A
13	UniProt	VAR_001419	G	35	E	CDN2A_HUMAN	Disease (CMM2)	746834149	A	G	35	E
14	UniProt	VAR_058551	G	35	V	CDN2A_HUMAN	Disease (CMM2)	---	A	G	35	V
15	UniProt	VAR_001420	P	48	L	CDN2A_HUMAN	Disease (CMM2)	---	A	P	48	L
16	UniProt	VAR_001421	I	49	S	CDN2A_HUMAN	Unclassified	---	A	I	49	S
17	UniProt	VAR_001422	I	49	T	CDN2A_HUMAN	Polymorphism	199907548	A	I	49	T
18	UniProt	VAR_001423	Q	50	R	CDN2A_HUMAN	Disease (CMM2)	587778189	A	Q	50	R
19	UniProt	VAR_001424	M	53	I	CDN2A_HUMAN	Disease (CMM2)	104894095	A	M	53	I
20	UniProt	VAR_001425	S	56	I	CDN2A_HUMAN	Polymorphism	104894109	A	S	56	I
21	UniProt	VAR_001426	A	57	V	CDN2A_HUMAN	Unclassified	372266620	A	A	57	V
22	UniProt	VAR_053027	R	58	Q	CDN2A_HUMAN	Polymorphism	36204273	A	R	58	Q
23	UniProt	VAR_001427	V	59	G	CDN2A_HUMAN	Disease (CMM2)	104894099	A	V	59	G
24	UniProt	VAR_001428	A	60	T	CDN2A_HUMAN	Polymorphism	769382085	A	A	60	T
25	UniProt	VAR_053028	A	60	V	CDN2A_HUMAN	Unclassified	36204594	A	A	60	V
26	UniProt	VAR_001430	L	62	P	CDN2A_HUMAN	Disease (CMM2)	---	A	L	62	P
27	UniProt	VAR_001431	H	66	Y	CDN2A_HUMAN	Unclassified	---	A	H	66	Y
28	UniProt	VAR_058553	G	67	R	CDN2A_HUMAN	Disease (CMM2)	758389471	A	G	67	R
29	UniProt	VAR_001432	A	68	L	CDN2A_HUMAN	Disease (CMM2)	876658534	A	A	68	L
30	UniProt	VAR_001433	A	68	T	CDN2A_HUMAN	Unclassified	---	A	A	68	T
31	UniProt	VAR_001434	A	68	V	CDN2A_HUMAN	Polymorphism	---	A	A	68	V
32	UniProt	VAR_058554	E	69	G	CDN2A_HUMAN	Polymorphism	372670098	A	E	69	G
33	UniProt	VAR_001435	E	69	K	CDN2A_HUMAN	Unclassified	---	A	E	69	K
34	UniProt	VAR_001436	E	69	V	CDN2A_HUMAN	Unclassified	---	A	E	69	V
35	UniProt	VAR_001437	N	71	K	CDN2A_HUMAN	Disease (CMM2)	---	A	N	71	K
36	UniProt	VAR_001438	N	71	S	CDN2A_HUMAN	Polymorphism	559848002	A	N	71	S
37	UniProt	VAR_001439	C	72	G	CDN2A_HUMAN	Unclassified	---	A	C	72	G
38	UniProt	VAR_001440	D	74	N	CDN2A_HUMAN	Unclassified	---	A	D	74	N
39	UniProt	VAR_001441	D	74	V	CDN2A_HUMAN	Unclassified	---	A	D	74	V
40	UniProt	VAR_058555	D	74	Y	CDN2A_HUMAN	Disease (CMM2)	760640852	A	D	74	Y
41	UniProt	VAR_058556	T	77	P	CDN2A_HUMAN	Disease (CMM2)	---	A	T	77	P
42	UniProt	VAR_001442	R	80	L	CDN2A_HUMAN	Unclassified	---	A	R	80	L
43	UniProt	VAR_058557	R	80	P	CDN2A_HUMAN	Disease (CMM2)	---	A	R	80	P
44	UniProt	VAR_001443	P	81	L	CDN2A_HUMAN	Unclassified	11552823	A	P	81	L
45	UniProt	VAR_058558	P	81	T	CDN2A_HUMAN	Disease (CMM2)	---	A	P	81	T
46	UniProt	VAR_001445	H	83	N	CDN2A_HUMAN	Unclassified	---	A	H	83	N
47	UniProt	VAR_053029	H	83	Q	CDN2A_HUMAN	Polymorphism	34968276	A	H	83	Q
48	UniProt	VAR_001444	H	83	Y	CDN2A_HUMAN	Unclassified	121913385	A	H	83	Y
49	UniProt	VAR_001446	D	84	E	CDN2A_HUMAN	Unclassified	---	A	D	84	E
50	UniProt	VAR_001447	D	84	H	CDN2A_HUMAN	Unclassified	---	A	D	84	H
51	UniProt	VAR_001448	D	84	N	CDN2A_HUMAN	Unclassified	11552822	A	D	84	N
52	UniProt	VAR_001449	D	84	Y	CDN2A_HUMAN	Disease (CMM2)	11552822	A	D	84	Y
53	UniProt	VAR_001450	A	85	T	CDN2A_HUMAN	Polymorphism	878853646	A	A	85	T
54	UniProt	VAR_001451	R	87	P	CDN2A_HUMAN	Disease (CMM2)	878853647	A	R	87	P
55	UniProt	VAR_012317	R	87	W	CDN2A_HUMAN	Disease (CMM2)	749714198	A	R	87	W
56	UniProt	VAR_001452	E	88	D	CDN2A_HUMAN	Unclassified	---	A	E	88	D
57	UniProt	VAR_001453	G	89	D	CDN2A_HUMAN	Disease (CMM2)	137854599	A	G	89	D
58	UniProt	VAR_001454	G	89	S	CDN2A_HUMAN	Disease (CMM2)	137854597	A	G	89	S
59	UniProt	VAR_001455	T	93	A	CDN2A_HUMAN	Unclassified	---	A	T	93	A
60	UniProt	VAR_023604	L	94	Q	CDN2A_HUMAN	Disease (CMM2)	---	A	L	94	Q
61	UniProt	VAR_001456	V	95	A	CDN2A_HUMAN	Unclassified	---	A	V	95	A
62	UniProt	VAR_001457	L	97	R	CDN2A_HUMAN	Disease (CMM2)	---	A	L	97	R
63	UniProt	VAR_001458	H	98	P	CDN2A_HUMAN	Disease (CMM2)	---	A	H	98	P
64	UniProt	VAR_001459	H	98	Q	CDN2A_HUMAN	Disease (CMM2)	---	A	H	98	Q
65	UniProt	VAR_001460	R	99	P	CDN2A_HUMAN	Disease (CMM2)	---	A	R	99	P
66	UniProt	VAR_001461	R	99	Q	CDN2A_HUMAN	Unclassified	754806883	A	R	99	Q
67	UniProt	VAR_053030	R	99	W	CDN2A_HUMAN	Polymorphism	34886500	A	R	99	W
68	UniProt	VAR_001462	A	100	L	CDN2A_HUMAN	Disease (CMM2)	---	A	A	100	L
69	UniProt	VAR_001463	A	100	P	CDN2A_HUMAN	Polymorphism	---	A	A	100	P
70	UniProt	VAR_001464	G	101	W	CDN2A_HUMAN	Disease (CMM2)	104894094	A	G	101	W
71	UniProt	VAR_015818	A	102	E	CDN2A_HUMAN	Polymorphism	137854598	A	A	102	E
72	UniProt	VAR_053031	A	102	T	CDN2A_HUMAN	Polymorphism	35741010	A	A	102	T
73	UniProt	VAR_001466	R	107	C	CDN2A_HUMAN	Disease (CMM2)	---	A	R	107	C
74	UniProt	VAR_001467	R	107	H	CDN2A_HUMAN	Polymorphism	370823171	A	R	107	H
75	UniProt	VAR_001469	D	108	H	CDN2A_HUMAN	Unclassified	---	A	D	108	H
76	UniProt	VAR_001468	D	108	Y	CDN2A_HUMAN	Unclassified	121913381	A	D	108	Y
77	UniProt	VAR_001470	P	114	L	CDN2A_HUMAN	Unclassified	121913386	A	P	114	L
78	UniProt	VAR_058559	P	114	S	CDN2A_HUMAN	Polymorphism	104894104	A	P	114	S
79	UniProt	VAR_001471	L	117	M	CDN2A_HUMAN	Disease (CMM2)	---	A	L	117	M
80	UniProt	VAR_001472	A	118	T	CDN2A_HUMAN	Disease (CMM2)	---	A	A	118	T
81	UniProt	VAR_001473	E	119	Q	CDN2A_HUMAN	Unclassified	---	A	E	119	Q
82	UniProt	VAR_001474	E	120	A	CDN2A_HUMAN	Unclassified	---	A	E	120	A
83	UniProt	VAR_001475	E	120	K	CDN2A_HUMAN	Unclassified	---	A	E	120	K
84	UniProt	VAR_035069	G	122	R	CDN2A_HUMAN	Disease (CMM2)	113798404	A	G	122	R
85	UniProt	VAR_001476	G	122	S	CDN2A_HUMAN	Unclassified	113798404	A	G	122	S
86	UniProt	VAR_001477	H	123	Q	CDN2A_HUMAN	Unclassified	6413463	A	H	123	Q
87	UniProt	VAR_053032	R	124	C	CDN2A_HUMAN	Polymorphism	34170727	A	R	124	C
88	UniProt	VAR_001478	R	124	H	CDN2A_HUMAN	Unclassified	747621669	A	R	124	H
89	UniProt	VAR_001479	V	126	D	CDN2A_HUMAN	Disease (CMM2)	104894098	A	V	126	D
90	UniProt	VAR_001480	A	127	S	CDN2A_HUMAN	Unclassified	6413464	A	A	127	S
91	UniProt	VAR_001481	A	132	P	CDN2A_HUMAN	Unclassified	---	A	A	132	P
92	UniProt	VAR_001482	A	134	V	CDN2A_HUMAN	Unclassified	757497674	A	A	134	V
93	UniProt	VAR_001483	H	142	Y	CDN2A_HUMAN	Unclassified	---	A	H	142	Y
94	UniProt	VAR_001484	R	144	C	CDN2A_HUMAN	Unclassified	116150891	A	R	144	C
95	UniProt	VAR_001486	A	148	T	CDN2A_HUMAN	Polymorphism	3731249	A	A	148	T
96	UniProt	VAR_001487	G	150	V	CDN2A_HUMAN	Unclassified	---	A	G	150	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REP_REGION	PS50297	Ankyrin repeat region circular profile.	CDN2A_HUMAN	16-130	1	A:16-130

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5a	ENST00000304494	5a	ENSE00001833804	chr9:21975097-21974677	421	CDN2A_HUMAN	1-50	50	1	A:1-50	50
1.6c	ENST00000304494	6c	ENSE00001801793	chr9:21971207-21970901	307	CDN2A_HUMAN	51-153	103	1	A:51-153	103
1.10e	ENST00000304494	10e	ENSE00001936961	chr9:21968241-21967752	490	CDN2A_HUMAN	153-156	4	1	A:153-156	4

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:156
 aligned with CDN2A_HUMAN | P42771 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      
          CDN2A_HUMAN     1 MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD 156
               SCOP domains d2a5ea_ A: Cell cycle inhibitor p16ink4A                                                                                                                     SCOP domains
               CATH domains 2a5eA00 A:1-156  [code=1.25.40.20, no name defined]                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............hhhhhhhhh..hhhhhhhhhhh...........hhhhh.....hhhhhhhhhh..............hhhhhhhh..hhhhhhhhhh.............hhhhhhhh..hhhhhhhhhhh...................... Sec.struct. author
             SAPs(SNPs) (1) -------------E-P---P--DC-D-----PD-A------------LSR--I--IVQGT-P---YRLG-KG-N--P--LL-NET-PDD---AQA-RPPLWE----CH-----L--MTQA-RQC-DS----P-V-------Y-C---T-V------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------S---P----------E-------------T----------V-------TK-S--V-----PT-QH--W-S--------QQP-T----HY-----S-----K-S-H-------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------Q----------V--------------------------------VV----Y--------YN--------------W--------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------------------------------------------------------------------Y------------------------------------------------------------------------ SAPs(SNPs) (4)
                    PROSITE ---------------ANK_REP_REGION  PDB: A:16-130 UniProt: 16-130                                                                      -------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:1-50 UniProt: 1-50              ------------------------------------------------------------------------------------------------------1.10 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.6c  PDB: A:51-153 UniProt: 51-153                                                               --- Transcript 1 (2)
                 2a5e A   1 MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD 156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: beta-hairpin-alpha-hairpin repeat (81)

Superfamily: Ankyrin repeat (79)

Family: Ankyrin repeat (60)

Protein domain: Cell cycle inhibitor p16ink4A (5)

Human (Homo sapiens) [TaxId: 9606] (4)

d2a5ea_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.20, no name defined] (65)

Human (Homo sapiens) (31)

2a5eA00

A:1-156

(no "Pfam Domain" information available for 2A5E)

NMR Structure(hide GO term definitions)

Chain A (CDN2A_HUMAN | P42771)

molecular function
	GO:0051059	NF-kappaB binding	Interacting selectively and non-covalently with NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters.
	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	Stops, prevents or reduces the activity of a cyclin-dependent protein serine/threonine kinase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0090398	cellular senescence	A cell aging process stimulated in response to cellular stress, whereby normal cells lose the ability to divide through irreversible cell cycle arrest.
	GO:0032088	negative regulation of NF-kappaB transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0001953	negative regulation of cell-matrix adhesion	Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix.
	GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0042326	negative regulation of phosphorylation	Any process that stops, prevents or decreases the rate of addition of phosphate groups to a molecule.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:2000774	positive regulation of cellular senescence	Any process that activates or increases the frequency, rate or extent of cellular senescence.
	GO:2000111	positive regulation of macrophage apoptotic process	Any process that activates or increases the frequency, rate or extent of macrophage apoptotic process.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0090399	replicative senescence	A cell aging process associated with the dismantling of a cell as a response to telomere shortening and/or cellular aging.
	GO:0035986	senescence-associated heterochromatin focus assembly	The assembly of chromatin into senescence-associated heterochromatin foci (SAHF), transcriptionally-silent heterochromatin structures present in senescent cells, containing the condensed chromatin of one chromosome, and enriched for histone modifications. Formation of these chromatin structures is thought to repress expression of proliferation-promoting genes.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0035985	senescence-associated heterochromatin focus	A transcriptionally-silent heterochromatin structure present in senescent cells. Contains the condensed chromatin of one chromosome and is enriched for histone modifications. Thought to repress expression of proliferation-promoting genes.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2a5e)

	Sites
(no "Sites" information available for 2a5e)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a5e)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2a5e
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CDN2A_HUMAN \| P42771
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	155601
		Disease Information	:	OMIM

Access by GenAge ID
	0224
		Age Related Information	:	GenAge
	0226
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CDN2A_HUMAN \| P42771
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CDN2A_HUMAN \| P42771	:	1a5e 1bi7 1dc2

(no "Related Entries Specified in the PDB File" available for 2A5E)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (96, 96)

PROSITE Motifs (1, 1)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File