1AXM - JenaLib

Asymmetric Unit (21, 21)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ARG B:119 , ARG B:122 , IDS B:302	BINDING SITE FOR RESIDUE SGN B 301
02	AC2	SOFTWARE	ASN A:18 , LYS A:118 , GLN A:127 , LYS A:128 , ALA A:129 , LYS B:112 , SGN B:301 , SGN B:303 , HOH B:612 , HOH B:649	BINDING SITE FOR RESIDUE IDS B 302
03	AC3	SOFTWARE	ASN A:18 , LYS A:112 , LYS A:113 , LYS A:118 , ALA A:129 , LYS B:112 , LYS B:113 , ASN B:114 , IDS B:302 , IDS B:304	BINDING SITE FOR RESIDUE SGN B 303
04	AC4	SOFTWARE	ASN B:18 , LYS B:112 , LYS B:113 , LYS B:118 , SGN B:303 , SGN B:305	BINDING SITE FOR RESIDUE IDS B 304
05	AC5	SOFTWARE	ARG A:122 , LYS B:113 , LYS B:118 , GLN B:127 , LYS B:128 , ALA B:129 , IDS B:304	BINDING SITE FOR RESIDUE SGN B 305
06	AC6	SOFTWARE	ARG C:122 , IDS C:402	BINDING SITE FOR RESIDUE SGN C 401
07	AC7	SOFTWARE	LYS C:112 , SGN C:401 , SGN C:403 , ASN E:18 , LYS E:113 , GLN E:127 , LYS E:128 , ALA E:129	BINDING SITE FOR RESIDUE IDS C 402
08	AC8	SOFTWARE	LYS C:112 , LYS C:113 , ASN C:114 , IDS C:402 , IDS C:404 , ASN E:18 , LYS E:112 , LYS E:113 , LYS E:118	BINDING SITE FOR RESIDUE SGN C 403
09	AC9	SOFTWARE	ASN C:18 , LYS C:112 , LYS C:113 , LYS C:118 , SGN C:403 , SGN C:405	BINDING SITE FOR RESIDUE IDS C 404
10	BC1	SOFTWARE	LYS C:118 , GLN C:127 , LYS C:128 , ALA C:129 , IDS C:404	BINDING SITE FOR RESIDUE SGN C 405
11	BC2	SOFTWARE	LYS F:112 , ARG F:122 , SGN F:503	BINDING SITE FOR RESIDUE IDS F 502
12	BC3	SOFTWARE	LYS D:128 , LYS F:112 , LYS F:113 , ASN F:114 , IDS F:502 , IDS F:504	BINDING SITE FOR RESIDUE SGN F 503
13	BC4	SOFTWARE	LYS D:113 , LYS D:128 , HOH D:652 , ASN F:18 , LYS F:112 , LYS F:113 , LYS F:118 , SGN F:503 , SGN F:505	BINDING SITE FOR RESIDUE IDS F 504
14	BC5	SOFTWARE	LYS D:113 , LYS D:118 , GLN D:127 , HOH D:652 , LYS F:118 , GLN F:127 , LYS F:128 , ALA F:129 , IDS F:504 , IDS F:506 , HOH F:641	BINDING SITE FOR RESIDUE SGN F 505
15	BC6	SOFTWARE	ASN D:18 , LYS D:113 , LYS D:118 , LYS F:128 , SGN F:505	BINDING SITE FOR RESIDUE IDS F 506
16	HPA	UNKNOWN	ASN A:18 , LYS A:112 , LYS A:113 , ASN A:114 , GLY A:115 , SER A:116 , CYS A:117 , LYS A:118 , ARG A:119 , GLY A:120 , PRO A:121 , ARG A:122 , THR A:123 , HIS A:124 , TYR A:125 , GLY A:126 , GLN A:127 , LYS A:128	HEPARIN BINDING LOOP.
17	HPB	UNKNOWN	ASN B:18 , LYS B:112 , LYS B:113 , ASN B:114 , GLY B:115 , SER B:116 , CYS B:117 , LYS B:118 , ARG B:119 , GLY B:120 , PRO B:121 , ARG B:122 , THR B:123 , HIS B:124 , TYR B:125 , GLY B:126 , GLN B:127 , LYS B:128	HEPARIN BINDING LOOP.
18	HPC	UNKNOWN	ASN C:18 , LYS C:112 , LYS C:113 , ASN C:114 , GLY C:115 , SER C:116 , CYS C:117 , LYS C:118 , ARG C:119 , GLY C:120 , PRO C:121 , ARG C:122 , THR C:123 , HIS C:124 , TYR C:125 , GLY C:126 , GLN C:127 , LYS C:128	HEPARIN BINDING LOOP.
19	HPD	UNKNOWN	ASN D:18 , LYS D:112 , LYS D:113 , ASN D:114 , GLY D:115 , SER D:116 , CYS D:117 , LYS D:118 , ARG D:119 , GLY D:120 , PRO D:121 , ARG D:122 , THR D:123 , HIS D:124 , TYR D:125 , GLY D:126 , GLN D:127 , LYS D:128	HEPARIN BINDING LOOP.
20	HPE	UNKNOWN	ASN E:18 , LYS E:112 , LYS E:113 , ASN E:114 , GLY E:115 , SER E:116 , CYS E:117 , LYS E:118 , ARG E:119 , GLY E:120 , PRO E:121 , ARG E:122 , THR E:123 , HIS E:124 , TYR E:125 , GLY E:126 , GLN E:127 , LYS E:128	HEPARIN BINDING LOOP.
21	HPF	UNKNOWN	ASN F:18 , LYS F:112 , LYS F:113 , ASN F:114 , GLY F:115 , SER F:116 , CYS F:117 , LYS F:118 , ARG F:119 , GLY F:120 , PRO F:121 , ARG F:122 , THR F:123 , HIS F:124 , TYR F:125 , GLY F:126 , GLN F:127 , LYS F:128	HEPARIN BINDING LOOP.

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (3, 18)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:130
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:130
                                    33        43        53        63        73        83        93       103       113       123       133       143       153
           FGF1_HUMAN    24 KKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 153
               SCOP domains d1axma_ A: Acidic FGF (FGF1)                                                                                                       SCOP domains
               CATH domains 1axmA00 A:9-138  [code=2.80.10.50, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeee.....eeee.........eeee.....eeeeee.....eee.......eee....hhheeeeee.....eeeee...hhh..............hhh.........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------HBGF_FGF  PDB: A:71-94  -------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: A:9-42            ----------------------------------Exon 1.10f  PDB: A:77-138 UniProt: 92-155 [INCOMPLETE]         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.9b  PDB: A:42-76            -------------------------------------------------------------- Transcript 1 (2)
                 1axm A   9 KKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 138
                                    18        28        38        48        58        68        78        88        98       108       118       128       138
                                                                                     67-MSE

Chain B from PDB  Type:PROTEIN  Length:127
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:127
                                    35        45        55        65        75        85        95       105       115       125       135       145       
           FGF1_HUMAN    26 PKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 152
               SCOP domains d1axmb_ B: Acidic FGF (FGF1)                                                                                                    SCOP domains
               CATH domains 1axmB00 B:11-137  [code=2.80.10.50, no name defined]                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeee.....eeee.........eeeee.....eeeee.....eee.......eee....hhh.eeeeee...eeeeee...hhh..............hhh.....hhh.eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------HBGF_FGF  PDB: B:71-94  ------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: B:11-42         ----------------------------------Exon 1.10f  PDB: B:77-137 UniProt: 92-155 [INCOMPLETE]        Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.9b  PDB: B:42-76            ------------------------------------------------------------- Transcript 1 (2)
                 1axm B  11 PKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 137
                                    20        30        40        50        60      | 70        80        90       100       110       120       130       
                                                                                   67-MSE

Chain C from PDB  Type:PROTEIN  Length:128
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:128
                                    34        44        54        64        74        84        94       104       114       124       134       144        
           FGF1_HUMAN    25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 152
               SCOP domains d1axmc_ C: Acidic FGF (FGF1)                                                                                                     SCOP domains
               CATH domains 1axmC00 C:10-137  [code=2.80.10.50, no name defined]                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeee.....eeee.........eeeee.....eeeee.....eee.......eee....hhh.eeeee.....eeeee...hhh..............hhh.....hhh.eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------HBGF_FGF  PDB: C:71-94  ------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: C:10-42          ----------------------------------Exon 1.10f  PDB: C:77-137 UniProt: 92-155 [INCOMPLETE]        Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.9b  PDB: C:42-76            ------------------------------------------------------------- Transcript 1 (2)
                 1axm C  10 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 137
                                    19        29        39        49        59       |69        79        89        99       109       119       129        
                                                                                    67-MSE

Chain D from PDB  Type:PROTEIN  Length:127
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:127
                                    35        45        55        65        75        85        95       105       115       125       135       145       
           FGF1_HUMAN    26 PKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 152
               SCOP domains d1axmd_ D: Acidic FGF (FGF1)                                                                                                    SCOP domains
               CATH domains 1axmD00 D:11-137  [code=2.80.10.50, no name defined]                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeee.....eeee.........eeeeeee..eeeeee.....eee.......eee....hhh.eeeee.....eeeee.hhhhh..............hhh.....hhh.eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------HBGF_FGF  PDB: D:71-94  ------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: D:11-42         ----------------------------------Exon 1.10f  PDB: D:77-137 UniProt: 92-155 [INCOMPLETE]        Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.9b  PDB: D:42-76            ------------------------------------------------------------- Transcript 1 (2)
                 1axm D  11 PKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV 137
                                    20        30        40        50        60      | 70        80        90       100       110       120       130       
                                                                                   67-MSE

Chain E from PDB  Type:PROTEIN  Length:129
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:129
                                    34        44        54        64        74        84        94       104       114       124       134       144         
           FGF1_HUMAN    25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 153
               SCOP domains d1axme_ E: Acidic FGF (FGF1)                                                                                                      SCOP domains
               CATH domains 1axmE00 E:10-138  [code=2.80.10.50, no name defined]                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeee.....eeee.........eeee.......eeee.....eee.......eee....hhh.eeeee.....eeeee...hhh..............hhh.....hhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------HBGF_FGF  PDB: E:71-94  -------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: E:10-42          ----------------------------------Exon 1.10f  PDB: E:77-138 UniProt: 92-155 [INCOMPLETE]         Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.9b  PDB: E:42-76            -------------------------------------------------------------- Transcript 1 (2)
                 1axm E  10 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 138
                                    19        29        39        49        59       |69        79        89        99       109       119       129         
                                                                                    67-MSE

Chain F from PDB  Type:PROTEIN  Length:129
 aligned with FGF1_HUMAN | P05230 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:129
                                    34        44        54        64        74        84        94       104       114       124       134       144         
           FGF1_HUMAN    25 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 153
               SCOP domains d1axmf_ F: Acidic FGF (FGF1)                                                                                                      SCOP domains
               CATH domains 1axmF00 F:10-138  [code=2.80.10.50, no name defined]                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeee.....eeee.........eeee.......eeee.....eee.......eee....hhh.eeeee.....eeeee...hhh..............hhh.....hhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------HBGF_FGF  PDB: F:71-94  -------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8b  PDB: F:10-42          ----------------------------------Exon 1.10f  PDB: F:77-138 UniProt: 92-155 [INCOMPLETE]         Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.9b  PDB: F:42-76            -------------------------------------------------------------- Transcript 1 (2)
                 1axm F  10 KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAmDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS 138
                                    19        29        39        49        59       |69        79        89        99       109       119       129         
                                                                                    67-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (57, 57)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (FGF1_HUMAN | P05230)

molecular function
	GO:0016303	1-phosphatidylinositol-3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+).
	GO:0030544	Hsp70 protein binding	Interacting selectively and non-covalently with Hsp70 proteins, any of a group of heat shock proteins around 70kDa in size.
	GO:0005088	Ras guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0044548	S100 protein binding	Interacting selectively and non-covalently with a S100 protein. S100 is a small calcium and zinc binding protein produced in astrocytes that is implicated in Alzheimer's disease, Down Syndrome and ALS.
	GO:0005104	fibroblast growth factor receptor binding	Interacting selectively and non-covalently with the fibroblast growth factor receptor (FGFR).
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0000187	activation of MAPK activity	The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
	GO:0032148	activation of protein kinase B activity	Any process that initiates the activity of the inactive enzyme protein kinase B.
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0060681	branch elongation involved in ureteric bud branching	The growth of a branch of the ureteric bud along its axis.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0034605	cellular response to heat	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0072163	mesonephric epithelium development	The process whose specific outcome is the progression of an epithelium in the mesonephros over time, from its formation to the mature structure. An epithelium is a tissue that covers the internal or external surfaces of an anatomical structure.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0001759	organ induction	The interaction of two or more cells or tissues that causes them to change their fates and specify the development of an organ.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol-3-phosphate, a phosphatidylinositol monophosphate carrying the phosphate group at the 3-position.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0045766	positive regulation of angiogenesis	Any process that activates or increases angiogenesis.
	GO:0051781	positive regulation of cell division	Any process that activates or increases the frequency, rate or extent of cell division.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045542	positive regulation of cholesterol biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of cholesterol.
	GO:0010595	positive regulation of endothelial cell migration	Any process that increases the rate, frequency, or extent of the orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0050679	positive regulation of epithelial cell proliferation	Any process that activates or increases the rate or extent of epithelial cell proliferation.
	GO:1902533	positive regulation of intracellular signal transduction	Any process that activates or increases the frequency, rate or extent of intracellular signal transduction.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:1903672	positive regulation of sprouting angiogenesis	Any process that activates or increases the frequency, rate or extent of sprouting angiogenesis.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:2000544	regulation of endothelial cell chemotaxis to fibroblast growth factor	Any process that modulates the frequency, rate or extent of endothelial cell chemotaxis to fibroblast growth factor.
	GO:1901509	regulation of endothelial tube morphogenesis	Any process that modulates the frequency, rate or extent of endothelial tube morphogenesis.
	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 21)

Sites (21, 21)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (3, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (57, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File