Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE PROTEINASE K AT 0.98 ANGSTROMS
 
Authors :  T. Masuda, M. Suzuki, S. Inoue, K. Numata, M. Sugahara
Date :  20 Jul 16  (Deposition) - 07 Jun 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.98
Chains :  Asym./Biol. Unit :  A
Keywords :  Serine Protease, Hydrolysis, Aminolysis, Catalytic Triad, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Masuda, M. Suzuki, S. Inoue, C. Song, T. Nakane, E. Nango, R. Tanaka, K. Tono, Y. Joti, T. Kameshima, T. Hatsui, M. Yabashi, B. Mikami, O. Nureki, K. Numata, S. Iwata, M. Sugahara
Atomic Resolution Structure Of Serine Protease Proteinase K At Ambient Temperature.
Sci Rep V. 7 45604 2017
PubMed-ID: 28361898  |  Reference-DOI: 10.1038/SREP45604

(-) Compounds

Molecule 1 - PROTEINASE K
    Chains: A
    EC Number: 3.4.21.64
    Mutation: YES
    Organism Scientific: ENGYODONTIUM ALBUM
    Organism Taxid: 37998
    Other Details: SIGMA-ALDRICH (P2308)
    Synonym: ENDOPEPTIDASE K,TRITIRACHIUM ALKALINE PROTEINASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2GOL2Ligand/IonGLYCEROL
3NO31Ligand/IonNITRATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:60 , TYR A:61 , LYS A:94 , ASP A:97 , ASP A:98 , HOH A:423 , HOH A:581binding site for residue NO3 A 301
2AC2SOFTWAREARG A:188 , ARG A:189 , LYS A:242 , THR A:243 , SER A:247 , ASN A:263 , HOH A:471 , HOH A:616 , HOH A:631binding site for residue GOL A 302
3AC3SOFTWAREPRO A:175 , VAL A:177 , ASP A:200 , CA A:304 , HOH A:414 , HOH A:488 , HOH A:492 , HOH A:588 , HOH A:636binding site for residue GOL A 303
4AC4SOFTWAREPRO A:175 , VAL A:177 , ASP A:200 , GOL A:303 , HOH A:492 , HOH A:534binding site for residue CA A 304
5AC5SOFTWARETHR A:16 , ASP A:260 , HOH A:567 , HOH A:647 , HOH A:688 , HOH A:698binding site for residue CA A 305

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:34 -A:123
2A:178 -A:249

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:170 -Pro A:171

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KXV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KXV)

(-) Exons   (0, 0)

(no "Exon" information available for 5KXV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:279
                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee...hhhhhhh.........ee........eeeeeee......hhhhh..eeeeee.........hhhhhhhhhhhh.........eeeeee........hhhhhhhhhhhhhhhhhhh....eeeeee...ee.hhhhhhhhhhhhhh.eeeeee......hhh.ee.......eeeeee.................eeee...eeeee...eeeee.hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhee............ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kxv A   1 AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA 279
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KXV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KXV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KXV)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:170 - Pro A:171   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kxv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRTK_PARAQ | P06873
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.64
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PRTK_PARAQ | P06873
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRTK_PARAQ | P06873: 1bjr 1cnm 1egq 1ht3 1ic6 1oyo 1p7v 1p7w 1pek 1pfg 1pj8 1ptk 2dp4 2dqk 2duj 2g4v 2hd4 2hpz 2id8 2pkc 2pq2 2prk 2pwa 2pwb 2pyz 2v8b 3aj8 3aj9 3d9q 3ddz 3de0 3de1 3de2 3de3 3de4 3de5 3de6 3de7 3dvq 3dvr 3dvs 3dw1 3dw3 3dwe 3dyb 3gt3 3gt4 3i2y 3i30 3i34 3i37 3l1k 3osz 3prk 3ptl 3q40 3q5g 3qmp 4b5l 4dj5 4fon 4wob 4woc 4zar 5amx 5avj 5avk 5b1d 5b1e 5cw1 5i9s 5k7s 5kxu 5uvl

(-) Related Entries Specified in the PDB File

5kxu