Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ACOUSTIC INJECTORS FOR DROP-ON-DEMAND SERIAL FEMTOSECOND CRYSTALLOGRAPHY
 
Authors :  C. G. Roessler, R. Agarwal, M. Allaire, R. Alonso-Mori, B. Andi, J. F. R. M. Bommer, A. S. Brewster, M. C. Browne, R. Chatterjee, E. Cho, A. E. Coh M. Cowan, S. Datwani, V. L. Davidson, J. Defever, B. Eaton, R. Ellson, Y L. P. Ghislain, J. M. Glownia, G. Han, J. Hattne, J. Hellmich, A. Heroux M. Ibrahim, J. Kern, A. Kuczewski, H. T. Lemke, P. Liu, L. Majlof, W. M. Mcclintock, S. Myers, S. Nelsen, J. Olechno, A. M. Orville, N. K. S A. S. Soares, M. S. Soltis, H. Song, R. G. Stearns, R. Tran, Y. Tsai, M. Uervirojnangkoorn, C. M. Wilmot, V. Yachandra, J. Yano, E. T. Yukl, A. Zouni
Date :  14 Jan 16  (Deposition) - 27 Jan 16  (Release) - 20 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Ring-Hydroxylating Dioxygenase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. G. Roessler, R. Agarwal, M. Allaire, R. Alonso-Mori, B. Andi, J. F. Bachega, M. Bommer, A. S. Brewster, M. C. Browne, R. Chatterjee, E. Cho, A. E. Cohen, M. Cowan, S. Datwani, V. L. Davidson, J. Defever, B. Eaton, R. Ellson, Y. Feng, L. P. Ghislain, J. M. Glownia, G. Han, J. Hattne, J. Hellmich, A. Heroux, M. Ibrahim, J. Kern, A. Kuczewski, H. T. Lemke, P. Liu, L. Majlof, W. M. Mcclintock, S. Myers, S. Nelsen, J. Olechno, A. M. Orville, N. K. Sauter, A. S. Soares, S. M. Soltis, H. Song, R. G. Stearns, R. Tran, Y. Tsai, M. Uervirojnangkoorn, C. M. Wilmot, V. Yachandra, J. Yano, E. T. Yukl, D. Zhu, A. Zouni
Acoustic Injectors For Drop-On-Demand Serial Femtosecond Crystallography.
Structure V. 24 631 2016
PubMed-ID: 26996959  |  Reference-DOI: 10.1016/J.STR.2016.02.007

(-) Compounds

Molecule 1 - RING-HYDROXYLATING DIOXYGENASE
    Chains: A
    Engineered: YES
    Expression System: SINORHIZOBIUM MELILOTI 1021
    Expression System Taxid: 266834
    Gene: SMA0751
    Organism Common: ENSIFER MELILOTI
    Organism Scientific: RHIZOBIUM MELILOTI 1021
    Organism Taxid: 266834
    Strain: 1021

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1FE1Ligand/IonFE (III) ION
2FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
3NCO1Ligand/IonCOBALT HEXAMMINE(III)

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:86 , HIS A:88 , ARG A:89 , CYS A:106 , TYR A:108 , HIS A:109 , TRP A:111binding site for residue FES A 501
2AC2SOFTWAREHIS A:204 , HIS A:209 , ASP A:360 , HOH A:696binding site for residue FE A 502
3AC3SOFTWARELEU A:12 , ASP A:13 , ARG A:15binding site for residue NCO A 503

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:202 -A:205

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:289 -Pro A:290
2Tyr A:301 -Pro A:302

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HL4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HL4)

(-) Exons   (0, 0)

(no "Exon" information available for 5HL4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:397
                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh........hhhhhhhhhhhhhhhhh.....eeeee.hhhh...eeeeeee..eeeeeee.....eeeee..............eee...ee......ee.....eee................eeeeeee..eeeee.......hhhhhhhhhhhhhhhhhh.eeeeeeeeeee..hhhhhhhhhhh.hhhhhh..hhhhhh...........hhhhhhhhhhhhhh......ee.....eeeeee..............................eeeeee...eeeee....eeeeeeeeee..eeeeeeeeeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hl4 A   6 TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP 406
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225|      239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
                                                                                                                                                                                                                                                     225|                                                                                                                                                                                
                                                                                                                                                                                                                                                      230
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HL4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HL4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HL4)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NCO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:289 - Pro A:290   [ RasMol ]  
    Tyr A:301 - Pro A:302   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hl4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q92ZP9_RHIME | Q92ZP9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q92ZP9_RHIME | Q92ZP9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q92ZP9_RHIME | Q92ZP9: 3vca 3vcp 4qup 4quq 4qur

(-) Related Entries Specified in the PDB File

5f80 STRUCTURE SOLVED USING THE SAME ACOUSTIC INJECTOR.
5f81 STRUCTURE SOLVED USING THE SAME ACOUSTIC INJECTOR.