Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF IMP DEHYDROGENASE FROM ASHBYA GOSSYPII BOUND TO ATP AND GDP
 
Authors :  D. Fernandez-Justel, J. M. De Pereda, J. L. Revuelta, R. M. Buey
Date :  14 Sep 16  (Deposition) - 14 Jun 17  (Release) - 14 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.46
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Keywords :  Imp Dehydrogenase, Ashbya Gossypii, Allosteric Modulator, Purine Nucleotides, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. M. Buey, D. Fernandez-Justel, I. Marcos-Alcalde, G. Winter, P. Gomez-Puertas, J. M. De Pereda, J. Luis Revuelta
A Nucleotide-Controlled Conformational Switch Modulates The Activity Of Eukaryotic Imp Dehydrogenases.
Sci Rep V. 7 2648 2017
PubMed-ID: 28572600  |  Reference-DOI: 10.1038/S41598-017-02805-X

(-) Compounds

Molecule 1 - INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    Chains: A, B
    EC Number: 1.1.1.205
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: AGOS_AER117W
    Organism Scientific: ASHBYA GOSSYPII ATCC 10895
    Organism Taxid: 284811
    Synonym: IMPDH

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (4x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 9)

Asymmetric Unit (4, 9)
No.NameCountTypeFull Name
15GP2Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT1Ligand/IonACETATE ION
3ATP2Ligand/IonADENOSINE-5'-TRIPHOSPHATE
4GDP4Ligand/IonGUANOSINE-5'-DIPHOSPHATE
Biological Unit 1 (4, 36)
No.NameCountTypeFull Name
15GP8Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT4Ligand/IonACETATE ION
3ATP8Ligand/IonADENOSINE-5'-TRIPHOSPHATE
4GDP16Ligand/IonGUANOSINE-5'-DIPHOSPHATE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:74 , ASN A:306 , ARG A:325 , GLY A:331 , SER A:332 , CYS A:334 , THR A:336 , ASP A:367 , GLY A:369 , GLN A:371 , MET A:388 , GLY A:390 , GLY A:391 , TYR A:414 , GLY A:418 , GLN A:448binding site for residue 5GP A 600
2AC2SOFTWARETHR A:165 , ARG A:167 , ASP A:168 , THR A:184 , ASP A:186 , VAL A:187 , ILE A:188 , LYS A:208 , GLY A:209 , LYS A:210 , GDP A:602 , HOH A:707 , HOH A:708 , ARG B:167 , LYS B:207 , ATP B:601binding site for residue ATP A 601
3AC3SOFTWARELYS A:115 , TYR A:116 , ASN A:118 , PRO A:124 , VAL A:125 , PHE A:145 , ALA A:146 , GLY A:147 , LYS A:210 , MET A:223 , SER A:225 , THR A:227 , ASP A:228 , LYS A:231 , ATP A:601 , HOH A:707 , HOH A:708binding site for residue GDP A 602
4AC4SOFTWAREGLU A:117 , ASN A:118 , GLY A:119 , ASN A:200 , ASP A:228 , LEU A:229 , ASN A:232 , PRO A:236 , LYS A:240 , LYS A:245binding site for residue GDP A 603
5AC5SOFTWAREARG B:260 , HOH B:723binding site for residue ACT A 604
6AC6SOFTWARESER B:74 , ASN B:306 , ARG B:325 , GLY B:331 , SER B:332 , CYS B:334 , THR B:336 , ASP B:367 , GLY B:369 , GLN B:371 , MET B:388 , GLY B:390 , GLY B:391 , TYR B:414 , GLY B:418 , SER B:419 , GLN B:448 , HOH B:701binding site for residue 5GP B 600
7AC7SOFTWAREARG A:167 , LYS A:207 , ATP A:601 , ILE B:163 , THR B:165 , ARG B:167 , ASP B:168 , THR B:184 , ASP B:186 , VAL B:187 , ILE B:188 , LYS B:208 , GLY B:209 , LYS B:210 , GDP B:602 , HOH B:702 , HOH B:706 , HOH B:707binding site for residue ATP B 601
8AC8SOFTWARELYS B:115 , TYR B:116 , ASN B:118 , ILE B:121 , PRO B:124 , VAL B:125 , PHE B:145 , ALA B:146 , GLY B:147 , LYS B:210 , MET B:223 , SER B:225 , THR B:227 , ASP B:228 , LYS B:231 , ATP B:601 , HOH B:702binding site for residue GDP B 602
9AC9SOFTWAREGLU B:117 , ASN B:118 , GLY B:119 , LEU B:196 , ASN B:200 , ASP B:228 , LEU B:229 , ASN B:232 , TYR B:235 , PRO B:236 , LYS B:240 , LYS B:245binding site for residue GDP B 603

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TC3)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:305 -Asn A:306
2Gly B:305 -Asn B:306

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TC3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TC3)

(-) Exons   (0, 0)

(no "Exon" information available for 5TC3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:488
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh........hhhhhhh......hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhh.....ee.........hhhhhhhhhhhhh...eeee........eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh...eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee.................eeee...........eeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tc3 A   2 TYRDAATALEHLATYAEKDGLSVEQLMDSKTGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFRRLKTYRGSIDAAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYELFD 522
                                    11        21        31||      42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402 |||   418   ||  452       462       472       482       492       502       512    ||  
                                                         32|                                                                                                                                                                                                                                                                                                                                                                               404||  415| 422|                                                                   517|  
                                                          34                                                                                                                                                                                                                                                                                                                                                                                406|   418  447                                                                    520  
                                                                                                                                                                                                                                                                                                                                                                                                                                             410                                                                                    


Chain B from PDB  Type:PROTEIN  Length:489
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh........hhhhhhhhhhhh..hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh...eeee........eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh...eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee..................eeee............eeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tc3 B   2 TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFRDRLKTYRGSIDAMAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSLFD 522
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401  |||| 414||    |449       459       469       479       489       499       509     ||  
                                                                                                                                                                                                                                                                                                                                                                                                                                            404|||  415|  423|                                                                 515|  
                                                                                                                                                                                                                                                                                                                                                                                                                                             406||   418   447                                                                  520  
                                                                                                                                                                                                                                                                                                                                                                                                                                              407|                                                                                   
                                                                                                                                                                                                                                                                                                                                                                                                                                               410
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TC3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TC3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TC3)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5GP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:305 - Asn A:306   [ RasMol ]  
    Gly B:305 - Asn B:306   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tc3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q756Z6_ASHGO | Q756Z6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.205
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q756Z6_ASHGO | Q756Z6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q756Z6_ASHGO | Q756Z6: 5mcp
UniProtKB/TrEMBL
        Q756Z6_ASHGO | Q756Z6: 4xtd 4xti 4xwu 4z0g 4z87

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5TC3)