Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CHAETOMIUM THERMOPHILUM HETEROTRIMERIC NUP82 NTD-NUP159 TAIL-NUP145N APD COMPLEX
 
Authors :  T. Stuwe, C. J. Bley, K. Thierbach, S. Petrovic, S. Schilbach, D. J. Mayo T. Perriches, E. J. Rundlet, Y. E. Jeon, L. N. Collins, D. H. Lin, M. Padu A. Koide, V. Lu, J. Fischer, E. Hurt, S. Koide, A. A. Kossiakoff, A. Hoel
Date :  28 Jul 15  (Deposition) - 16 Sep 15  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Nucleocytoplasmic Transport, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Stuwe, C. J. Bley, K. Thierbach, S. Petrovic, S. Schilbach, D. J. Mayo, T. Perriches, E. J. Rundlet, Y. E. Jeon, L. N. Collins, F. M. Huber, D. H. Lin, M. Paduch, A. Koide, V. Lu, J. Fischer, E. Hurt, S. Koide, A. A. Kossiakoff, A. Hoelz
Architecture Of The Fungal Nuclear Pore Inner Ring Complex.
Science V. 350 56 2015
PubMed-ID: 26316600  |  Reference-DOI: 10.1126/SCIENCE.AAC9176

(-) Compounds

Molecule 1 - NUCLEOPORIN NUP145N
    Chains: A
    EC Number: 3.4.21.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 858-993
    Gene: NUP145, CTHT_0042590
    Organism Scientific: CHAETOMIUM THERMOPHILUM (STRAIN DSM 1495 / CBS 144.50 / IMI 039719)
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
    Synonym: NUCLEAR PORE PROTEIN NUP145
 
Molecule 2 - NUCLEOPORIN NUP82
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1-595
    Gene: NUP82, CTHT_0022610
    Organism Scientific: CHAETOMIUM THERMOPHILUM (STRAIN DSM 1495 / CBS 144.50 / IMI 039719)
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
    Synonym: NUCLEAR PORE PROTEIN NUP82
 
Molecule 3 - NUCLEOPORIN NUP159
    Chains: C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1449-1480
    Gene: NUP159, CTHT_0054650
    Organism Scientific: CHAETOMIUM THERMOPHILUM (STRAIN DSM 1495 / CBS 144.50 / IMI 039719)
    Organism Taxid: 759272
    Strain: DSM 1495 / CBS 144.50 / IMI 039719
    Synonym: NUCLEAR PORE PROTEIN NUP159

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5CWW)

(-) Sites  (0, 0)

(no "Site" information available for 5CWW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CWW)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Ser A:863 -Pro A:864
2Glu B:14 -Pro B:15
3Cys B:285 -Pro B:286
4Arg B:362 -Pro B:363
5Gly B:371 -Pro B:372
6Thr B:516 -Pro B:517

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CWW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CWW)

(-) Exons   (0, 0)

(no "Exon" information available for 5CWW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:140
                                                                                                                                                                             
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.hhhhhhh...hhhhh....eeee...eeeee.........hhhhh....eeee..eeee..hhhhh..........eeeee............hhhhhhhhhhhhh....eeeee......eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5cww A  854 GPHMGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNINLDDLFGTIVILEPRSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGRRLERHIERLKSIPDTTFESYDPETGVWAFSVEHF  993
                                   863       873       883       893       903       913       923       933       943       953       963       973       983       993


Chain B from PDB  Type:PROTEIN  Length:538
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhh..hhhhhhh.........eeee..eeeeee..eeeeeehhhhhhhhhh...........eeeee........eeee.....eeeee....eeeee..hhhhhh..........eee............eeeeee...hhhh.eeeeee...eeeeee.....hhhhhh..eeeehhhhhh....................hhhhhh.eeeee........hhhhheeeee....eeee......ee....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...eee........eeeee..........ee...eee......hhhhhheeeeeee...........eeeeee....eeeee...........................eeeeeeee...hhhhh......eeee......eeeeee..eeeeee..hhhhhhhhhhh.....hhhhhhhhhhhh...eeeeeee...........eeeee...eeeeeee....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5cww B    3 KIKSFAPAWLNEPAPGHKLFAPKPGPRRTIARRGTEIFVACGKQIRWGDLAQLKESWESRPSDDGAATAGYRIIKTPVADDIRQLVMSPNQDFLAVLTSHTVHICILPDSSHLHIQDTTPFKPKFWTLGPTTHVTSRSAVVSAVWHPLGVNGHALVTVTEDAIVRVWELSTADRWTFDAPTLAIDLKKLADATYLDQDFGVSTSATNKGFSPDAFDMEVAAACFPTRDSGGWAPMTLWLAMTSGDVYALCPLLPQRWTPPPTLIPSLSASIVAKVAAAEDNPESTPEERLVAQQQLEWMSEIDNQEPKLVEEATGEATIEVYTRPSRPGLVPKLQGPFDFDLNPEDEQDDEVELKDIYVIGEKPRNGLSLNIICLLSTSGQVKICLDIDGVEAQWLPPRSKNKRLFAPPPEPPSLLTFQTFDTLKPAEVTPDGWPMFSEDATSPYSFYVTHPAGITYISLTPWVFRLESELQSDSEAGTEFRIDLLAKGQGSERDRIFTQTRTQSPLAAATSIDDPDLGYFILSATQTDPIALFFETP  593
                                    12        22 ||     49        59        69        79 ||    105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395    || 425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585        
                                                24|                                     81|                                                                                                                                                                                                                                                                                                           400|                                                                                                                                                                            
                                                 42                                      98                                                                                                                                                                                                                                                                                                            421                                                                                                                                                                            


Chain C from PDB  Type:PROTEIN  Length:32
                                                                 
               SCOP domains -------------------------------- SCOP domains
               CATH domains -------------------------------- CATH domains
               Pfam domains -------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh..ee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------- PROSITE
                 Transcript -------------------------------- Transcript
                5cww C 1440 LRAREAKRKATLRMLRESLARVGPNVVRLRDD 1471
                                  1449      1459      1469
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CWW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CWW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CWW)

(-) Gene Ontology  (9, 23)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5cww)
 
  Sites
(no "Sites" information available for 5cww)
 
  Cis Peptide Bonds
    Arg B:362 - Pro B:363   [ RasMol ]  
    Cys B:285 - Pro B:286   [ RasMol ]  
    Glu B:14 - Pro B:15   [ RasMol ]  
    Gly B:371 - Pro B:372   [ RasMol ]  
    Ser A:863 - Pro A:864   [ RasMol ]  
    Thr B:516 - Pro B:517   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cww
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NU145_CHATD | G0SAK3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NU159_CHATD | G0SBS8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NUP82_CHATD | G0S4F3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NU145_CHATD | G0SAK3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NU159_CHATD | G0SBS8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NUP82_CHATD | G0S4F3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NU145_CHATD | G0SAK3: 5hb0 5hb5 5hb6

(-) Related Entries Specified in the PDB File

5cws 5cwt 5cwu 5cwv