Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CLA-ER, A NOVEL ENONE REDUCTASE CATALYZING A KEY STEP OF A GUT-BACTERIAL FATTY ACID SATURATION METABOLISM, BIOHYDROGENATION
 
Authors :  F. Hou, T. Miyakawa, M. Tanokura
Date :  13 Jun 14  (Deposition) - 25 Feb 15  (Release) - 11 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Nadh Oxidase/Flavin Reductase Family, Enone Reductase, Fmn, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Hou, T. Miyakawa, N. Kitamura, M. Takeuchi, S. B. Park, S. Kishino, J. Ogawa, M. Tanokura
Structure And Reaction Mechanism Of A Novel Enone Reductase
Febs J. 2015
PubMed-ID: 25702712  |  Reference-DOI: 10.1111/FEBS.13239

(-) Compounds

Molecule 1 - ENONE REDUCTASE CLA-ER
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CLA-ER
    Organism Scientific: LACTOBACILLUS PLANTARUM
    Organism Taxid: 1590
    Strain: AKU 1009A

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1FMN4Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:20 , HIS A:21 , SER A:22 , ARG A:24 , PHE A:77 , ASN A:78 , GLN A:81 , ASN A:165 , ALA A:166 , PHE A:167 , SER A:168 , GLY A:169 , THR A:204 , ARG A:206 , HOH A:425 , HOH A:427 , HOH A:430 , HOH A:437 , HOH A:444 , HOH A:465 , PRO B:48 , SER B:49 , ALA B:50 , ASN B:52 , ILE B:144BINDING SITE FOR RESIDUE FMN A 301
2AC2SOFTWAREPRO A:48 , SER A:49 , ALA A:50 , ASN A:52 , ILE A:144 , HOH A:412 , HOH A:416 , ARG B:20 , HIS B:21 , SER B:22 , ARG B:24 , PHE B:77 , ASN B:78 , GLN B:81 , ASN B:165 , ALA B:166 , PHE B:167 , SER B:168 , GLY B:169 , THR B:204 , ARG B:206 , HOH B:422 , HOH B:425 , HOH B:432 , HOH B:440 , HOH B:447BINDING SITE FOR RESIDUE FMN B 301
3AC3SOFTWAREARG C:20 , HIS C:21 , SER C:22 , ARG C:24 , PHE C:77 , ASN C:78 , GLN C:81 , ASN C:165 , ALA C:166 , PHE C:167 , SER C:168 , GLY C:169 , THR C:204 , ARG C:206 , HOH C:423 , HOH C:426 , HOH C:439 , HOH C:454 , PRO D:48 , SER D:49 , ALA D:50 , ASN D:52 , ILE D:144 , HOH D:460BINDING SITE FOR RESIDUE FMN C 301
4AC4SOFTWAREPRO C:48 , SER C:49 , ALA C:50 , ASN C:52 , ILE C:144 , HOH C:428 , HOH C:450 , ARG D:20 , HIS D:21 , SER D:22 , ARG D:24 , PHE D:77 , ASN D:78 , GLN D:81 , ASN D:165 , ALA D:166 , PHE D:167 , SER D:168 , GLY D:169 , THR D:204 , ARG D:206 , HOH D:426 , HOH D:427 , HOH D:446 , HOH D:464BINDING SITE FOR RESIDUE FMN D 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4QLY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4QLY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4QLY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4QLY)

(-) Exons   (0, 0)

(no "Exon" information available for 4QLY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh.............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee......hhhhhh......eeeeeeeeee............hhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4qly A   8 LVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAATAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDVWNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYDANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA 217
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217


Chain B from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh.............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee......hhhhhh......eeeeeeeeee............hhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4qly B   8 LVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAATAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDVWNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYDANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA 217
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217


Chain C from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh.............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee......hhhhhh......eeeeeeeeee............hhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4qly C   8 LVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAATAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDVWNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYDANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA 217
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217


Chain D from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh.............hhhhhhhhhhhhh...hhhhh..eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee......hhhhhh......eeeeeeeeee............hhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4qly D   8 LVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAATAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDVWNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYDANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA 217
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4QLY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4QLY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4QLY)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4qly)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4qly
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  U6C5W9_LACPN | U6C5W9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  U6C5W9_LACPN | U6C5W9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        U6C5W9_LACPN | U6C5W9: 4qlx

(-) Related Entries Specified in the PDB File

4qlx