Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF LEPTOSPIRA INTERROGANS LRR PROTEIN LIC12234
 
Authors :  W. Shepard, F. A. Saul, A. Haouz, M. Picardeau
Date :  10 Jul 14  (Deposition) - 03 Jun 15  (Release) - 17 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.39
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Lrr Protein, Pathogen, Virulence Factor, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Miras, F. Saul, M. Nowakowski, P. Weber, A. Haouz, W. Shepard, M. Picardeau
Structural Characterization Of A Novel Subfamily Of Leucine-Rich Repeat Proteins From The Human Pathogen Leptospira Interrogans.
Acta Crystallogr. , Sect. D V. 71 1351 2015
PubMed-ID: 26057675  |  Reference-DOI: 10.1107/S139900471500704X

(-) Compounds

Molecule 1 - LIC12234
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PDEST17
    Expression System Taxid: 469008
    Expression System Variant: PLYSS
    Gene: LIC_12234
    Mutation: YES
    Organism Scientific: LEPTOSPIRA INTERROGANS
    Organism Taxid: 173
    Strain: FIOCRUZ L1-130

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 18)

Asymmetric Unit (3, 18)
No.NameCountTypeFull Name
1ACT4Ligand/IonACETATE ION
2CL6Ligand/IonCHLORIDE ION
3ZN8Ligand/IonZINC ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2CL-1Ligand/IonCHLORIDE ION
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2CL-1Ligand/IonCHLORIDE ION
3ZN-1Ligand/IonZINC ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:71 , ASP A:94 , CL A:306 , GLU B:212binding site for residue ZN A 301
02AC2SOFTWAREHIS A:31 , GLU A:43 , ACT A:308 , HOH A:433 , ASP B:36binding site for residue ZN A 302
03AC3SOFTWARELYS A:91 , GLU A:114 , HOH A:455 , GLU B:208binding site for residue ZN A 303
04AC4SOFTWAREGLU A:82 , GLU A:106 , GLU B:82 , GLU B:106binding site for residue ZN A 304
05AC5SOFTWAREGLU A:208 , LYS B:91 , GLU B:114binding site for residue ZN A 305
06AC6SOFTWARESER A:50 , HIS A:71 , ASP A:94 , ZN A:301 , HOH A:564 , GLU B:212binding site for residue CL A 306
07AC7SOFTWAREGLU A:157 , HOH A:431binding site for residue ACT A 307
08AC8SOFTWAREHIS A:31 , ZN A:302 , HOH A:433 , HOH A:614 , ASN B:33 , ASP B:36binding site for residue ACT A 308
09AC9SOFTWAREGLU A:212 , HIS B:71 , ASP B:94 , CL B:404binding site for residue ZN A 309
10AD1SOFTWARESER A:69 , HIS A:71 , ARG B:201 , THR B:210 , ILE B:211 , HOH B:657binding site for residue CL B 401
11AD2SOFTWAREGLU A:43 , HOH A:411 , HIS B:31 , HOH B:511binding site for residue ZN B 402
12AD3SOFTWARETHR A:210 , HOH A:628 , SER B:69 , HIS B:71binding site for residue CL B 403
13AD4SOFTWAREGLU A:212 , ZN A:309 , HOH A:633 , SER B:50 , HIS B:71 , ARG B:73 , ASP B:94binding site for residue CL B 404
14AD5SOFTWARELYS A:59 , HOH A:430 , LYS B:105 , PRO B:127 , GLU B:128binding site for residue ACT B 405
15AD6SOFTWAREGLU B:132 , CL B:407 , CL B:408binding site for residue ZN B 406
16AD7SOFTWAREGLU B:132 , ZN B:406 , CL B:408binding site for residue CL B 407
17AD8SOFTWAREGLU B:132 , GLN B:155 , ZN B:406 , CL B:407binding site for residue CL B 408
18AD9SOFTWAREGLU B:114 , HOH B:551 , HOH B:672binding site for residue ACT B 409

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TZH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TZH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TZH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TZH)

(-) Exons   (0, 0)

(no "Exon" information available for 4TZH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh.eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tzh A  25 PKEVIIHKNLSDALKTPNEVQILDLSRNQLTILPKEIEQLVNLESLHLRDNELTTLPEEIGILKNLKYLDISRNQISNFPKEIQKLKNLEVLFLNGNSLSNLPEEIGELEKLGILYLNNNQLTTLPKEIGQLENLVSLSLSSNKLTSIPDELGQLKKLRILNLWDNPTLTTPERNIRKLFRNQEITIEIS 214
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214


Chain B from PDB  Type:PROTEIN  Length:186
                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhh.eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhh....eee.........hhhhhhhhh.....eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tzh B  29 IIHKNLSDALKTPNEVQILDLSRNQLTILPKEIEQLVNLESLHLRDNELTTLPEEIGILKNLKYLDISRNQISNFPKEIQKLKNLEVLFLNGNSLSNLPEEIGELEKLGILYLNNNQLTTLPKEIGQLENLVSLSLSSNKLTSIPDELGQLKKLRILNLWDNPTLTTPERNIRKLFRNQEITIEIS 214
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TZH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TZH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TZH)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4TZH)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tzh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tzh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q72Q78_LEPIC | Q72Q78
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q72Q78_LEPIC | Q72Q78
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4TZH)

(-) Related Entries Specified in the PDB File

4u06 4u08 4u09