Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE MOCVNH-LYSM MODULE FROM THE RICE BLAST FUNGUS MAGNAPORTHE ORYZAE PROTEIN (MGG_03307)
 
Authors :  L. M. I. Koharudin, A. R. Viscomi, B. Montanini, M. J. Kershaw, N. J. Talb S. Ottonello, A. M. Gronenborn
Date :  26 Feb 11  (Deposition) - 23 Mar 11  (Release) - 22 Jun 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (25x)
NMR Structure *:  A  (1x)
Keywords :  Cvnh, Lectin, Carbohydrate, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. M. Koharudin, A. R. Viscomi, B. Montanini, M. J. Kershaw, N. J. Talbot, S. Ottonello, A. M. Gronenborn
Structure-Function Analysis Of A Cvnh-Lysm Lectin Expressed During Plant Infection By The Rice Blast Fungus Magnaporthe Oryzae.
Structure V. 19 662 2011
PubMed-ID: 21565701  |  Reference-DOI: 10.1016/J.STR.2011.03.004

(-) Compounds

Molecule 1 - CVNH-LYSM LECTIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-15B
    Expression System Strain: ROSETTA2 DE3
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 174-340
    Gene: MGG_03307
    Organism Common: RICE BLAST FUNGUS
    Organism Scientific: MAGNAPORTHE ORYZAE 70-15
    Organism Taxid: 242507
    Other Details: EXPRESSED AS HIS-TAG FUSION PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (25x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L9Y)

(-) Sites  (0, 0)

(no "Site" information available for 2L9Y)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2L9Y)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L9Y)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2L9Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2L9Y)

(-) Exons   (0, 0)

(no "Exon" information available for 2L9Y)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:167
 aligned with G4N991_MAGO7 | G4N991 from UniProtKB/TrEMBL  Length:340

    Alignment length:167
                                   183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       
         G4N991_MAGO7   174 GNYAGNFSGSSRDICLDGARLRAECRRGDGGYSTSVIDLNRYLSNDNGHFRWVSGGGGGGGTATVTVQQGDTLRDIGRRFDCDFHEIARRNNIQNEDLIYPGQVLQVPTKGGSGGGAGNFWDSARDVRLVDGGKVLEAELRYSGGWNRSRIYLDEHIGNRNGELIHC 340
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhh.........eeeeeeee...eeeeeeee....eee....eee..........eeeee....hhhhhhhhh..hhhhhhhhhh.hhhhh....eeeee...........hhhh.eeeeeee....eeeeeeee..eeeeeeehhhh.eee....eee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2l9y A   1 GNYAGNFSGSSRDICLDGARLRAECRRGDGGYSTSVIDLNRYLSNDNGHFRWVSGGGGGGGTATVTVQQGDTLRDIGRRFDCDFHEIARRNNIQNEDLIYPGQVLQVPTKGGSGGGAGNFWDSARDVRLVDGGKVLEAELRYSGGWNRSRIYLDEHIGNRNGELIHC 167
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2L9Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L9Y)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2L9Y)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (G4N991_MAGO7 | G4N991)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0043581    obsolete mycelium development    OBSOLETE. The process whose specific outcome is the progression of the mycelium over time, from its formation to the mature structure. A mycelium consists of a mass of branching, thread-like hyphae.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l9y)
 
  Sites
(no "Sites" information available for 2l9y)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l9y)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l9y
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G4N991_MAGO7 | G4N991
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G4N991_MAGO7 | G4N991
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        G4N991_MAGO7 | G4N991: 5c8o 5c8p 5c8q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2L9Y)