|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric Unit (3, 6) Biological Unit 1 (2, 6) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2X5G) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2X5G) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2X5G) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2X5G) |
Exons (0, 0)| (no "Exon" information available for 2X5G) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:91 aligned with Y131_SIRV1 | Q8QL44 from UniProtKB/Swiss-Prot Length:131 Alignment length:94 11 21 31 41 51 61 71 81 91 Y131_SIRV1 2 ASLKEIIDELGKQAKEQNKIASRILKIKGIKRIVVQLNAVPQDGKIRYSLTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFTP 95 SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 2x5g A 2 ASLKEIIDELGKQAKEQNKIASRILKIKGIKRIVVQLNAVP---KIRYSmTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFTP 95 11 21 31 41| | 51 61 71 81 91 42 46 | 51-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2X5G) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2X5G) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2X5G) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2X5G)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|